BLASTX nr result
ID: Phellodendron21_contig00012536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00012536 (435 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDN41090.1 hypothetical protein BN871_AB_00880 [Paenibacillus sp... 82 1e-16 KMS64782.1 hypothetical protein BVRB_042720, partial [Beta vulga... 69 3e-13 CCD04733.1 protein of unknown function [Legionella pneumophila s... 69 5e-13 KMS65097.1 hypothetical protein BVRB_039480, partial [Beta vulga... 67 2e-12 EDM97731.1 hypothetical protein BACCAP_04474 [Pseudoflavonifract... 69 3e-12 KMS64527.1 hypothetical protein BVRB_019370, partial [Beta vulga... 66 5e-12 CKA55183.1 degenerate transposase [Streptococcus pneumoniae] 67 1e-11 CRH31484.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1}... 65 2e-11 OLF42126.1 hypothetical protein BUQ66_25075, partial [Vibrio par... 65 2e-11 CBX28569.1 hypothetical protein N47_G38930 [uncultured Desulfoba... 66 2e-11 OKY32969.1 hypothetical protein BT101_26070, partial [Vibrio par... 64 4e-11 OKY28108.1 hypothetical protein BTU71_25070 [Vibrio parahaemolyt... 64 4e-11 ABZ84906.1 hypothetical protein HM1_3148 [Heliobacterium modesti... 65 6e-11 OKY32951.1 hypothetical protein BT101_26100 [Vibrio parahaemolyt... 64 7e-11 ABP91180.1 unknown protein [Streptococcus suis 98HAH33] ABP91259... 67 7e-11 CEH44550.1 conserved hypothetical protein [Xanthomonas citri pv.... 64 9e-11 JAN29471.1 hypothetical protein, partial [Daphnia magna] 67 1e-10 CDI66870.1 Putative uncharacterized protein [Bifidobacterium ani... 64 2e-10 JAN87919.1 hypothetical protein, partial [Daphnia magna] 67 2e-10 CDW93815.1 conserved hypothetical protein [Thiomonas sp. CB2] 64 2e-10 >CDN41090.1 hypothetical protein BN871_AB_00880 [Paenibacillus sp. P22] Length = 217 Score = 82.4 bits (202), Expect = 1e-16 Identities = 58/147 (39%), Positives = 65/147 (44%), Gaps = 3/147 (2%) Frame = -3 Query: 433 LILFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPR 254 LILFAPHAFAPQRQ PSP VFL ISTHFTAT ++P Sbjct: 38 LILFAPHAFAPQRQLQPRKSPSPLVFLHISTHFTAT-----------RGIPLSSSALKPC 86 Query: 253 SFTTDLDGPPTRALRPMIXXXXXXXXXXXXXXXXXPPYYRGCWHGVSRCLFAGYRQAA-- 80 SF DL G + P YYRGCWH VS+ YR Sbjct: 87 SFPCDL-GLSPKIKHRTYKAACARFTPNNSGQRLPPTYYRGCWHVVSQGFLLRYRHGGSS 145 Query: 79 -LTPPSSPTKGVYGPRPFLPHAASLRQ 2 + SS +Y P+ FL HAA LRQ Sbjct: 146 YSSTRSSLATELYDPKAFLTHAALLRQ 172 >KMS64782.1 hypothetical protein BVRB_042720, partial [Beta vulgaris subsp. vulgaris] Length = 57 Score = 69.3 bits (168), Expect = 3e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSA 312 SNPVCSPRFRAS S LVQ+ AFA+ VPPDLYAFH YT NSA Sbjct: 1 SNPVCSPRFRASVSVLVQVVAFATDVPPDLYAFHCYTGNSA 41 >CCD04733.1 protein of unknown function [Legionella pneumophila subsp. pneumophila] CCD06973.1 protein of unknown function [Legionella pneumophila subsp. pneumophila] CCD07889.1 protein of unknown function [Legionella pneumophila subsp. pneumophila] Length = 68 Score = 69.3 bits (168), Expect = 5e-13 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNS 315 SNPVCSPRFRAS S L Q+AAFA+GVP DLYAFHRYT NS Sbjct: 12 SNPVCSPRFRASVSVLGQVAAFATGVPSDLYAFHRYTGNS 51 >KMS65097.1 hypothetical protein BVRB_039480, partial [Beta vulgaris subsp. vulgaris] Length = 50 Score = 67.0 bits (162), Expect = 2e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPSMSPA 291 SNPVCSPRFR SAS LVQL AFA+GV P++Y FH YTRNS S + A Sbjct: 2 SNPVCSPRFRTSASVLVQLVAFATGVLPNIYEFHLYTRNSTNLSKTLA 49 >EDM97731.1 hypothetical protein BACCAP_04474 [Pseudoflavonifractor capillosus ATCC 29799] EDM98346.1 hypothetical protein BACCAP_03832 [Pseudoflavonifractor capillosus ATCC 29799] Length = 117 Score = 68.6 bits (166), Expect = 3e-12 Identities = 40/66 (60%), Positives = 40/66 (60%) Frame = -3 Query: 433 LILFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPR 254 LILFAPHAFAPQRQ SS PPSP VFLRISTHFTAT P VEP Sbjct: 42 LILFAPHAFAPQRQLLSSNPPSPLVFLRISTHFTATHGIPIASPALKNYSFKCRPQVEPV 101 Query: 253 SFTTDL 236 FT DL Sbjct: 102 VFTPDL 107 >KMS64527.1 hypothetical protein BVRB_019370, partial [Beta vulgaris subsp. vulgaris] Length = 55 Score = 66.2 bits (160), Expect = 5e-12 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPS 303 SNPVCSP FRAS S +VQ AFA+GVP D+YAFH YT NS+ PS Sbjct: 12 SNPVCSPSFRASVSGVVQRLAFATGVPLDIYAFHCYTENSSLPS 55 >CKA55183.1 degenerate transposase [Streptococcus pneumoniae] Length = 93 Score = 66.6 bits (161), Expect = 1e-11 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -2 Query: 431 NPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPSMSPAPQSPQ 276 N CSPRFRASAS Q AAFA+GVPP +YAFHRYT NS PS + Q P+ Sbjct: 19 NVXCSPRFRASASVTSQRAAFATGVPPYIYAFHRYTWNSTLPSCTQVKQFPK 70 >CRH31484.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH31347.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH31065.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH30496.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH28262.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH27628.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH27676.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH40540.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH40402.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH40122.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH39531.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH36738.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH35503.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH35381.1 Uncharacterized protein {ECO:0000313|EMBL:EEH89636.1} [Pantoea ananatis] CRH37056.1 Uncharacterized protein BN1183_CP_00520 [Pantoea ananatis] CRH36786.1 Uncharacterized protein BN1183_CN_00060 [Pantoea ananatis] CRH36195.1 Uncharacterized protein BN1183_CJ_02070 [Pantoea ananatis] CRH35023.1 Uncharacterized protein BN1183_CC_00150 [Pantoea ananatis] CRH32677.1 Uncharacterized protein BN1183_AI_00540 [Pantoea ananatis] CRH32004.1 Uncharacterized protein BN1183_AB_00530 [Pantoea ananatis] CRH32051.1 Uncharacterized protein BN1183_AB_01000 [Pantoea ananatis] Length = 74 Score = 65.5 bits (158), Expect = 2e-11 Identities = 33/64 (51%), Positives = 39/64 (60%) Frame = -3 Query: 427 LFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPRSF 248 +FAPHAFAP+RQ+ S PPSPPVFL+ISTHFTAT V+P F Sbjct: 1 MFAPHAFAPERQSSSRGPPSPPVFLQISTHFTATPGILPPSTRLKPASFKCSSQVKPGDF 60 Query: 247 TTDL 236 T+DL Sbjct: 61 TSDL 64 >OLF42126.1 hypothetical protein BUQ66_25075, partial [Vibrio parahaemolyticus] Length = 63 Score = 65.1 bits (157), Expect = 2e-11 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPSMSPAPQSPQ 276 SNP+CSPRFRASAS Q AAFA+GV P +YAF+RYT +S S SP Q P+ Sbjct: 7 SNPICSPRFRASASVTGQAAAFATGVLPYIYAFYRYTWSSTALSCSPVLQFPK 59 >CBX28569.1 hypothetical protein N47_G38930 [uncultured Desulfobacterium sp.] Length = 114 Score = 66.2 bits (160), Expect = 2e-11 Identities = 35/66 (53%), Positives = 40/66 (60%) Frame = -3 Query: 433 LILFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPR 254 LILFA HAFAPQRQ WS PSPPVFL IST+FT+T V+PR Sbjct: 39 LILFATHAFAPQRQYWSRKSPSPPVFLLISTNFTSTPGIPLPSPILKSFSFKCTSEVKPR 98 Query: 253 SFTTDL 236 +FT+DL Sbjct: 99 AFTSDL 104 >OKY32969.1 hypothetical protein BT101_26070, partial [Vibrio parahaemolyticus] Length = 63 Score = 64.3 bits (155), Expect = 4e-11 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPSMSPAPQ-SPQTPR 267 SNPVC PRFR+SAS + Q+ AFA+ VPPD+Y FH YT NS S +P Q Q PR Sbjct: 7 SNPVCYPRFRSSASVMCQIVAFATDVPPDIYGFHSYTWNSTILSHTPVCQFQRQFPR 63 >OKY28108.1 hypothetical protein BTU71_25070 [Vibrio parahaemolyticus] Length = 65 Score = 64.3 bits (155), Expect = 4e-11 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPSMSPAPQ-SPQTPR 267 SNPVC PRFR+SAS + Q+ AFA+ VPPD+Y FH YT NS S +P Q Q PR Sbjct: 9 SNPVCYPRFRSSASVMCQIVAFATDVPPDIYGFHSYTWNSTILSHTPVCQFQRQFPR 65 >ABZ84906.1 hypothetical protein HM1_3148 [Heliobacterium modesticaldum Ice1] Length = 113 Score = 65.1 bits (157), Expect = 6e-11 Identities = 38/66 (57%), Positives = 39/66 (59%) Frame = -3 Query: 433 LILFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPR 254 LILFAPHAFAPQRQ S PSP FL ISTHFTAT PGVE R Sbjct: 38 LILFAPHAFAPQRQVMSRQSPSPLGFLPISTHFTATPGIPLSSPSLKTSSFQGRPGVELR 97 Query: 253 SFTTDL 236 SFT+DL Sbjct: 98 SFTSDL 103 >OKY32951.1 hypothetical protein BT101_26100 [Vibrio parahaemolyticus] Length = 74 Score = 63.9 bits (154), Expect = 7e-11 Identities = 36/64 (56%), Positives = 38/64 (59%) Frame = -3 Query: 427 LFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPRSF 248 +FAPHAFAPQRQ SS PPSP VFL ISTHFTAT P VEP F Sbjct: 1 MFAPHAFAPQRQLLSSRPPSPLVFLLISTHFTATLGIPSASPVLKNYSFKCRPWVEPMVF 60 Query: 247 TTDL 236 T+DL Sbjct: 61 TSDL 64 >ABP91180.1 unknown protein [Streptococcus suis 98HAH33] ABP91259.1 unknown protein [Streptococcus suis 98HAH33] ABP91490.1 unknown protein [Streptococcus suis 98HAH33] ABP91585.1 unknown protein [Streptococcus suis 98HAH33] Length = 186 Score = 66.6 bits (161), Expect = 7e-11 Identities = 47/121 (38%), Positives = 50/121 (41%) Frame = -3 Query: 433 LILFAPHAFAPQRQTWSSWPPSPPVFLRISTHFTATXXXXXXXXXXXXXXXXXXPGVEPR 254 LILFAPHAF PQRQ + P SPPVFL ISTHFTAT + Sbjct: 38 LILFAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSALKFDSFQSVLWL--- 94 Query: 253 SFTTDLDGPPTRALRPMIXXXXXXXXXXXXXXXXXPPYYRGCWHGVSRCLFAGYRQAALT 74 S + L T R P YYRGCWH VSR YRQ Sbjct: 95 SHSLLLQTYQTACAR---------FTPNKSGQRSGPTYYRGCWHVVSRPFLVRYRQVRNF 145 Query: 73 P 71 P Sbjct: 146 P 146 >CEH44550.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH53236.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH63573.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI15548.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI35908.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH45445.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH54619.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH43564.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH65853.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH54717.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH78147.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI07031.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI16180.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH94281.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH96259.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH96714.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH78256.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH86587.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ25534.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ20944.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ48971.1 conserved hypothetical protein [Xanthomonas citri pv. bilvae] CEJ48847.1 conserved hypothetical protein [Xanthomonas citri pv. bilvae] CEL46623.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL39946.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL48748.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL34946.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE39505.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF35106.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF34770.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE39473.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE24912.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE74168.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF22932.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF22096.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF21556.1 conserved hypothetical protein [Xanthomonas citri pv. citri] Length = 99 Score = 64.3 bits (155), Expect = 9e-11 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 3/52 (5%) Frame = -3 Query: 148 PPYYRGCWHGVSRCLFAGYRQ--AALTPP-SSPTKGVYGPRPFLPHAASLRQ 2 P YYRGCWH VSRCLF GYRQ LT S PTKG+Y P+ F HAA L Q Sbjct: 3 PSYYRGCWHEVSRCLFFGYRQNNRVLTDCFSFPTKGLYNPKAFFTHAAWLDQ 54 >JAN29471.1 hypothetical protein, partial [Daphnia magna] Length = 206 Score = 66.6 bits (161), Expect = 1e-10 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPS 303 SNPVCSPRFR SAS VQLAAFA+GVP D+Y FH YT NS S Sbjct: 10 SNPVCSPRFRVSASVFVQLAAFATGVPLDIYEFHLYTENSTNLS 53 >CDI66870.1 Putative uncharacterized protein [Bifidobacterium animalis subsp. animalis IM386] Length = 94 Score = 63.5 bits (153), Expect = 2e-10 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPSMSPAPQSP 279 SNPV SPRFR+SAS Q AFA GV PD+Y FHRYT NS+ P +PA P Sbjct: 38 SNPVRSPRFRSSASVTAQRPAFAIGVLPDIYTFHRYTGNSSLPYRTPARPYP 89 >JAN87919.1 hypothetical protein, partial [Daphnia magna] Length = 245 Score = 66.6 bits (161), Expect = 2e-10 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = -2 Query: 434 SNPVCSPRFRASASDLVQLAAFASGVPPDLYAFHRYTRNSARPS 303 SNPVCSPRFR SAS VQLAAFA+GVP D+Y FH YT NS S Sbjct: 10 SNPVCSPRFRVSASVFVQLAAFATGVPLDIYEFHLYTENSTNLS 53 >CDW93815.1 conserved hypothetical protein [Thiomonas sp. CB2] Length = 99 Score = 63.5 bits (153), Expect = 2e-10 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 3/52 (5%) Frame = -3 Query: 148 PPYYRGCWHGVSRCLFAGYRQAALT---PPSSPTKGVYGPRPFLPHAASLRQ 2 P YYRGCWH VSRCLF GYR + S P K VY P+ F+PHAA L Q Sbjct: 3 PTYYRGCWHVVSRCLFCGYRHHRMVLALDISPPPKVVYNPKAFIPHAALLDQ 54