BLASTX nr result
ID: Phellodendron21_contig00011958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011958 (643 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006427196.1 hypothetical protein CICLE_v10025851mg [Citrus cl... 114 4e-27 KDO52886.1 hypothetical protein CISIN_1g017024mg [Citrus sinensi... 114 1e-26 XP_006427194.1 hypothetical protein CICLE_v10025851mg [Citrus cl... 114 1e-26 XP_006465500.1 PREDICTED: uncharacterized protein LOC102627782 [... 112 9e-26 >XP_006427196.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] ESR40436.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] Length = 302 Score = 114 bits (285), Expect = 4e-27 Identities = 54/73 (73%), Positives = 56/73 (76%) Frame = -3 Query: 641 PTPRYRSINDLRPGRTHDDRHDSGSNYSRWINHLQTHTVSYGRYNVESNRAPRDNGNVQS 462 PTPRYR IND R GRTHD+RHDS SNYSRW NHL T V YGR NVESNRA R N N Q Sbjct: 220 PTPRYRLINDFRIGRTHDNRHDSESNYSRWNNHLGTQRVHYGRSNVESNRASRHNDNSQQ 279 Query: 461 QRSRDQQGLRWRG 423 QR RD +GLRWRG Sbjct: 280 QRIRDHRGLRWRG 292 >KDO52886.1 hypothetical protein CISIN_1g017024mg [Citrus sinensis] KDO52887.1 hypothetical protein CISIN_1g017024mg [Citrus sinensis] KDO52888.1 hypothetical protein CISIN_1g017024mg [Citrus sinensis] Length = 379 Score = 114 bits (285), Expect = 1e-26 Identities = 54/73 (73%), Positives = 56/73 (76%) Frame = -3 Query: 641 PTPRYRSINDLRPGRTHDDRHDSGSNYSRWINHLQTHTVSYGRYNVESNRAPRDNGNVQS 462 PTPRYR IND R GRTHD+RHDS SNYSRW NHL T V YGR NVESNRA R N N Q Sbjct: 297 PTPRYRLINDFRIGRTHDNRHDSESNYSRWNNHLGTQRVHYGRSNVESNRASRHNDNSQQ 356 Query: 461 QRSRDQQGLRWRG 423 QR RD +GLRWRG Sbjct: 357 QRIRDHRGLRWRG 369 >XP_006427194.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] XP_006427195.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] XP_006427197.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] ESR40434.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] ESR40435.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] ESR40437.1 hypothetical protein CICLE_v10025851mg [Citrus clementina] Length = 379 Score = 114 bits (285), Expect = 1e-26 Identities = 54/73 (73%), Positives = 56/73 (76%) Frame = -3 Query: 641 PTPRYRSINDLRPGRTHDDRHDSGSNYSRWINHLQTHTVSYGRYNVESNRAPRDNGNVQS 462 PTPRYR IND R GRTHD+RHDS SNYSRW NHL T V YGR NVESNRA R N N Q Sbjct: 297 PTPRYRLINDFRIGRTHDNRHDSESNYSRWNNHLGTQRVHYGRSNVESNRASRHNDNSQQ 356 Query: 461 QRSRDQQGLRWRG 423 QR RD +GLRWRG Sbjct: 357 QRIRDHRGLRWRG 369 >XP_006465500.1 PREDICTED: uncharacterized protein LOC102627782 [Citrus sinensis] Length = 401 Score = 112 bits (280), Expect = 9e-26 Identities = 53/73 (72%), Positives = 55/73 (75%) Frame = -3 Query: 641 PTPRYRSINDLRPGRTHDDRHDSGSNYSRWINHLQTHTVSYGRYNVESNRAPRDNGNVQS 462 PTPRYR IND R GR HD+RHDS SNYSRW NHL T V YGR NVESNRA R N N Q Sbjct: 319 PTPRYRLINDFRIGRAHDNRHDSESNYSRWNNHLGTQRVHYGRSNVESNRASRHNDNSQQ 378 Query: 461 QRSRDQQGLRWRG 423 QR RD +GLRWRG Sbjct: 379 QRIRDHRGLRWRG 391