BLASTX nr result
ID: Phellodendron21_contig00011691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011691 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value P00290.1 RecName: Full=Plastocyanin prf||765954A plastocyanin 72 4e-14 ABG81099.1 b-plastocyanin, partial [Pelargonium x hortorum] 70 5e-14 P35476.1 RecName: Full=Plastocyanin A'/A'' AAB29408.1 b-plastocy... 70 2e-13 P35477.1 RecName: Full=Plastocyanin B'/B'' AAB29409.1 a-plastocy... 70 2e-13 P00297.1 RecName: Full=Plastocyanin prf||0512261A plastocyanin 70 2e-13 KRX12160.1 Plastocyanin, partial [Trichinella nelsoni] 70 2e-13 OMO87326.1 hypothetical protein CCACVL1_09124 [Corchorus capsula... 72 2e-13 XP_002510603.1 PREDICTED: plastocyanin B'/B'' [Ricinus communis]... 72 2e-13 KYP64791.1 hypothetical protein KK1_019397 [Cajanus cajan] 72 3e-13 XP_006828829.1 PREDICTED: plastocyanin [Amborella trichopoda] ER... 72 3e-13 XP_019244898.1 PREDICTED: plastocyanin A'/A'' [Nicotiana attenua... 72 3e-13 XP_004964252.1 PREDICTED: plastocyanin, chloroplastic-like [Seta... 71 3e-13 WP_071414663.1 plastocyanin [Acinetobacter baumannii] OIC31768.1... 70 3e-13 XP_014498793.1 PREDICTED: plastocyanin [Vigna radiata var. radiata] 71 4e-13 ACV32157.1 chloroplast plastocyanin precursor [Nicotiana bentham... 71 4e-13 P00295.1 RecName: Full=Plastocyanin 69 5e-13 ACN31203.1 unknown [Zea mays] 69 5e-13 prf||0512262B plastocyanin 69 5e-13 CDP13123.1 unnamed protein product [Coffea canephora] 68 5e-13 OMO75461.1 hypothetical protein COLO4_26078 [Corchorus olitorius] 71 6e-13 >P00290.1 RecName: Full=Plastocyanin prf||765954A plastocyanin Length = 99 Score = 72.0 bits (175), Expect = 4e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTLT KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 66 PGETYAVTLTEKGTYSFYCAPHQGAGMVGKVTVN 99 >ABG81099.1 b-plastocyanin, partial [Pelargonium x hortorum] Length = 53 Score = 70.5 bits (171), Expect = 5e-14 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTL+ KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 20 PGETYAVTLSEKGTYSFYCAPHQGAGMVGKVTVN 53 >P35476.1 RecName: Full=Plastocyanin A'/A'' AAB29408.1 b-plastocyanin, PCb(II) [Nicotiana tabacum=tobacco, var. Virginia, whole leaves, Peptide, 99 aa] Length = 99 Score = 70.5 bits (171), Expect = 2e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL+ KGTY+FYCAPHQGAGMVGKVTVN Sbjct: 66 PGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99 >P35477.1 RecName: Full=Plastocyanin B'/B'' AAB29409.1 a-plastocyanin, PCa(I) [Nicotiana tabacum=tobacco, var. Virginia, whole leaves, Peptide, 99 aa] Length = 99 Score = 70.5 bits (171), Expect = 2e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL+ KGTY+FYCAPHQGAGMVGKVTVN Sbjct: 66 PGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99 >P00297.1 RecName: Full=Plastocyanin prf||0512261A plastocyanin Length = 99 Score = 70.5 bits (171), Expect = 2e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL+ KGTYSFYC+PHQGAGMVGKVTVN Sbjct: 66 PGETYSVTLSEKGTYSFYCSPHQGAGMVGKVTVN 99 >KRX12160.1 Plastocyanin, partial [Trichinella nelsoni] Length = 101 Score = 70.5 bits (171), Expect = 2e-13 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTLT KGTYSFYC+PHQGAGM GKVTVN Sbjct: 68 PGETYSVTLTEKGTYSFYCSPHQGAGMAGKVTVN 101 >OMO87326.1 hypothetical protein CCACVL1_09124 [Corchorus capsularis] Length = 167 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTLT KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 134 PGETYAVTLTEKGTYSFYCAPHQGAGMVGKVTVN 167 >XP_002510603.1 PREDICTED: plastocyanin B'/B'' [Ricinus communis] EEF52790.1 Plastocyanin A, chloroplast precursor, putative [Ricinus communis] Length = 168 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTLT KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 135 PGETYAVTLTEKGTYSFYCAPHQGAGMVGKVTVN 168 >KYP64791.1 hypothetical protein KK1_019397 [Cajanus cajan] Length = 164 Score = 71.6 bits (174), Expect = 3e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 131 PGETYSVTLDAKGTYSFYCAPHQGAGMVGKVTVN 164 >XP_006828829.1 PREDICTED: plastocyanin [Amborella trichopoda] ERM96245.1 hypothetical protein AMTR_s00001p00142570 [Amborella trichopoda] Length = 167 Score = 71.6 bits (174), Expect = 3e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 134 PGETYSVTLDTKGTYSFYCAPHQGAGMVGKVTVN 167 >XP_019244898.1 PREDICTED: plastocyanin A'/A'' [Nicotiana attenuata] OIT03957.1 plastocyanin, chloroplastic [Nicotiana attenuata] Length = 169 Score = 71.6 bits (174), Expect = 3e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL+ KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 136 PGETYSVTLSEKGTYSFYCAPHQGAGMVGKVTVN 169 >XP_004964252.1 PREDICTED: plastocyanin, chloroplastic-like [Setaria italica] Length = 157 Score = 71.2 bits (173), Expect = 3e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTLTV GTYSFYC PHQGAGMVGKVTVN Sbjct: 124 PGETYSVTLTVPGTYSFYCEPHQGAGMVGKVTVN 157 >WP_071414663.1 plastocyanin [Acinetobacter baumannii] OIC31768.1 plastocyanin [Acinetobacter baumannii] Length = 128 Score = 70.5 bits (171), Expect = 3e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL+ KGTY+FYCAPHQGAGMVGKVTVN Sbjct: 95 PGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 128 >XP_014498793.1 PREDICTED: plastocyanin [Vigna radiata var. radiata] Length = 166 Score = 71.2 bits (173), Expect = 4e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL+ KGTYSFYC+PHQGAGMVGKVTVN Sbjct: 133 PGETYSVTLSAKGTYSFYCSPHQGAGMVGKVTVN 166 >ACV32157.1 chloroplast plastocyanin precursor [Nicotiana benthamiana] Length = 169 Score = 71.2 bits (173), Expect = 4e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTL KGTYSFYCAPHQGAGMVGKVTVN Sbjct: 136 PGETYSVTLNEKGTYSFYCAPHQGAGMVGKVTVN 169 >P00295.1 RecName: Full=Plastocyanin Length = 99 Score = 69.3 bits (168), Expect = 5e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTLT KG+YSFYC+PHQGAGMVGKVTVN Sbjct: 66 PGETYAVTLTEKGSYSFYCSPHQGAGMVGKVTVN 99 >ACN31203.1 unknown [Zea mays] Length = 99 Score = 69.3 bits (168), Expect = 5e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETYSVTLTV GTY FYC PHQGAGMVGK+TVN Sbjct: 66 PGETYSVTLTVPGTYGFYCEPHQGAGMVGKITVN 99 >prf||0512262B plastocyanin Length = 99 Score = 69.3 bits (168), Expect = 5e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTLT KG+YSFYC+PHQGAGMVGKVTVN Sbjct: 66 PGETYAVTLTEKGSYSFYCSPHQGAGMVGKVTVN 99 >CDP13123.1 unnamed protein product [Coffea canephora] Length = 43 Score = 67.8 bits (164), Expect = 5e-13 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGET+SV+LT KGTY+FYC+PHQGAGMVGKVTVN Sbjct: 10 PGETFSVSLTEKGTYTFYCSPHQGAGMVGKVTVN 43 >OMO75461.1 hypothetical protein COLO4_26078 [Corchorus olitorius] Length = 167 Score = 70.9 bits (172), Expect = 6e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 358 PGETYSVTLTVKGTYSFYCAPHQGAGMVGKVTVN 257 PGETY+VTLT KGTYSFYC+PHQGAGMVGKVTVN Sbjct: 134 PGETYAVTLTEKGTYSFYCSPHQGAGMVGKVTVN 167