BLASTX nr result
ID: Phellodendron21_contig00011590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011590 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAW22377.1 hypothetical protein ANO14919_119140 [fungal sp. No.1... 82 2e-18 EZF34034.1 40S ribosomal protein S14 [Trichophyton interdigitale... 82 2e-18 OJJ76193.1 hypothetical protein ASPBRDRAFT_38605, partial [Asper... 82 2e-18 KIM94886.1 hypothetical protein OIDMADRAFT_21204 [Oidiodendron m... 84 3e-18 XP_001908524.1 hypothetical protein [Podospora anserina S mat+] ... 84 3e-18 OLN95561.1 40S ribosomal protein S14 [Colletotrichum chlorophyti] 84 3e-18 CZR60033.1 probable CRP-2 40S ribosomal protein S14 [Phialocepha... 84 3e-18 OIW34125.1 hypothetical protein CONLIGDRAFT_641181 [Coniochaeta ... 84 3e-18 CZT46324.1 probable CRP-2 40S ribosomal protein S14 [Rhynchospor... 84 3e-18 XP_962951.1 40S ribosomal protein S14 [Neurospora crassa OR74A] ... 84 3e-18 OAA61911.1 40S ribosomal protein s14 [Sporothrix insectorum RCEF... 84 3e-18 KXJ94655.1 ribosomal protein S11-domain-containing protein [Micr... 84 3e-18 XP_018066092.1 hypothetical protein LY89DRAFT_688907 [Phialoceph... 84 3e-18 XP_003712792.1 40S ribosomal protein S14 [Magnaporthe oryzae 70-... 84 3e-18 KXX74644.1 hypothetical protein MMYC01_208151 [Madurella mycetom... 84 3e-18 KKF96717.1 40S ribosomal protein S14 [Ceratocystis platani] 84 3e-18 KFY34212.1 hypothetical protein V494_06966 [Pseudogymnoascus sp.... 84 3e-18 KFY27372.1 hypothetical protein V493_03537 [Pseudogymnoascus sp.... 84 3e-18 KFY16538.1 hypothetical protein V492_01256 [Pseudogymnoascus sp.... 84 3e-18 KFX87857.1 hypothetical protein O988_09256 [Pseudogymnoascus sp.... 84 3e-18 >GAW22377.1 hypothetical protein ANO14919_119140 [fungal sp. No.14919] Length = 92 Score = 82.4 bits (202), Expect = 2e-18 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGM+IGRIEDVTPTPSDST Sbjct: 42 GGNGTKTPGPGAQSALRALARSGMRIGRIEDVTPTPSDST 81 >EZF34034.1 40S ribosomal protein S14 [Trichophyton interdigitale H6] Length = 92 Score = 82.4 bits (202), Expect = 2e-18 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGM+IGRIEDVTPTPSDST Sbjct: 42 GGNGTKTPGPGAQSALRALARSGMRIGRIEDVTPTPSDST 81 >OJJ76193.1 hypothetical protein ASPBRDRAFT_38605, partial [Aspergillus brasiliensis CBS 101740] Length = 105 Score = 82.4 bits (202), Expect = 2e-18 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGM+IGRIEDVTPTPSDST Sbjct: 55 GGNGTKTPGPGAQSALRALARSGMRIGRIEDVTPTPSDST 94 >KIM94886.1 hypothetical protein OIDMADRAFT_21204 [Oidiodendron maius Zn] Length = 149 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 99 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 138 >XP_001908524.1 hypothetical protein [Podospora anserina S mat+] CAP69197.1 unnamed protein product [Podospora anserina S mat+] CDP32678.1 Putative cytosolic 40S ribosomal protein Rps14 [Podospora anserina S mat+] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >OLN95561.1 40S ribosomal protein S14 [Colletotrichum chlorophyti] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >CZR60033.1 probable CRP-2 40S ribosomal protein S14 [Phialocephala subalpina] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >OIW34125.1 hypothetical protein CONLIGDRAFT_641181 [Coniochaeta ligniaria NRRL 30616] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >CZT46324.1 probable CRP-2 40S ribosomal protein S14 [Rhynchosporium secalis] CZS93724.1 probable CRP-2 40S ribosomal protein S14 [Rhynchosporium agropyri] CZT05900.1 probable CRP-2 40S ribosomal protein S14 [Rhynchosporium commune] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >XP_962951.1 40S ribosomal protein S14 [Neurospora crassa OR74A] XP_009850518.1 40S ribosomal protein S14 [Neurospora tetrasperma FGSC 2508] EAA33715.1 40S ribosomal protein S14 [Neurospora crassa OR74A] EGO57395.1 40S ribosomal protein S14 [Neurospora tetrasperma FGSC 2508] EGZ72349.1 40S ribosomal protein S14 [Neurospora tetrasperma FGSC 2509] KHE84656.1 hypothetical protein GE21DRAFT_3956 [Neurospora crassa] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >OAA61911.1 40S ribosomal protein s14 [Sporothrix insectorum RCEF 264] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KXJ94655.1 ribosomal protein S11-domain-containing protein [Microdochium bolleyi] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >XP_018066092.1 hypothetical protein LY89DRAFT_688907 [Phialocephala scopiformis] KUJ11737.1 hypothetical protein LY89DRAFT_688907 [Phialocephala scopiformis] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >XP_003712792.1 40S ribosomal protein S14 [Magnaporthe oryzae 70-15] AAX07644.1 40S ribosomal protein S14-like protein [Magnaporthe grisea] ADD84596.1 ribosomal protein S14.e [Magnaporthe oryzae] EHA52985.1 40S ribosomal protein S14 [Magnaporthe oryzae 70-15] ELQ69410.1 40S ribosomal protein S14 [Magnaporthe oryzae P131] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KXX74644.1 hypothetical protein MMYC01_208151 [Madurella mycetomatis] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KKF96717.1 40S ribosomal protein S14 [Ceratocystis platani] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KFY34212.1 hypothetical protein V494_06966 [Pseudogymnoascus sp. VKM F-4513 (FW-928)] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KFY27372.1 hypothetical protein V493_03537 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KFY16538.1 hypothetical protein V492_01256 [Pseudogymnoascus sp. VKM F-4246] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139 >KFX87857.1 hypothetical protein O988_09256 [Pseudogymnoascus sp. VKM F-3808] KFX98357.1 hypothetical protein V490_02353 [Pseudogymnoascus sp. VKM F-3557] KFY37068.1 hypothetical protein V495_07400 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY50610.1 hypothetical protein V496_09286 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY56531.1 hypothetical protein V497_06174 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] KFY97442.1 hypothetical protein V498_02073 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] Length = 150 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 120 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST Sbjct: 100 GGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDST 139