BLASTX nr result
ID: Phellodendron21_contig00011369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011369 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP11659.1 hypothetical protein COLO4_03736 [Corchorus olitorius] 55 7e-07 >OMP11659.1 hypothetical protein COLO4_03736 [Corchorus olitorius] Length = 575 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 150 TTVPRSSALSLVMISAKEEPDSSLPPAMDG 239 TTVPRSSA S VM+S KEEPDSSLPPAMDG Sbjct: 192 TTVPRSSAFSPVMVSGKEEPDSSLPPAMDG 221