BLASTX nr result
ID: Phellodendron21_contig00011221
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011221 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO51256.1 hypothetical protein CISIN_1g009203mg [Citrus sinensis] 54 2e-06 XP_006485089.1 PREDICTED: U5 small nuclear ribonucleoprotein 40 ... 54 2e-06 XP_006436960.1 hypothetical protein CICLE_v10031176mg [Citrus cl... 54 2e-06 >KDO51256.1 hypothetical protein CISIN_1g009203mg [Citrus sinensis] Length = 540 Score = 54.3 bits (129), Expect = 2e-06 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 7/50 (14%) Frame = -3 Query: 259 EVIVKKPKQEEDE-----GDSSREEQEEALVALIEHRSKEAP--KERLFY 131 E+IVKKPKQEE+E G +S++EQEEALVALIEHR+KE ++R+ Y Sbjct: 3 ELIVKKPKQEEEEEEENGGCNSKDEQEEALVALIEHRTKEVQHLRQRISY 52 >XP_006485089.1 PREDICTED: U5 small nuclear ribonucleoprotein 40 kDa protein [Citrus sinensis] Length = 540 Score = 54.3 bits (129), Expect = 2e-06 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 7/50 (14%) Frame = -3 Query: 259 EVIVKKPKQEEDE-----GDSSREEQEEALVALIEHRSKEAP--KERLFY 131 E+IVKKPKQEE+E G +S++EQEEALVALIEHR+KE ++R+ Y Sbjct: 3 ELIVKKPKQEEEEEEENGGCNSKDEQEEALVALIEHRTKEVQHLRQRISY 52 >XP_006436960.1 hypothetical protein CICLE_v10031176mg [Citrus clementina] ESR50200.1 hypothetical protein CICLE_v10031176mg [Citrus clementina] Length = 540 Score = 54.3 bits (129), Expect = 2e-06 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 7/50 (14%) Frame = -3 Query: 259 EVIVKKPKQEEDE-----GDSSREEQEEALVALIEHRSKEAP--KERLFY 131 E+IVKKPKQEE+E G +S++EQEEALVALIEHR+KE ++R+ Y Sbjct: 3 ELIVKKPKQEEEEEEENGGCNSKDEQEEALVALIEHRTKEVQHLRQRISY 52