BLASTX nr result
ID: Phellodendron21_contig00011140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011140 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHG19725.1 Protein THEMIS2 [Gossypium arboreum] 54 9e-07 KDP25141.1 hypothetical protein JCGZ_22676 [Jatropha curcas] 54 1e-06 XP_007014877.1 PREDICTED: anoctamin-8 [Theobroma cacao] EOY32496... 54 1e-06 AFK42282.1 unknown [Lotus japonicus] 51 3e-06 XP_006445959.1 hypothetical protein CICLE_v10017123mg [Citrus cl... 52 4e-06 OMO68964.1 hypothetical protein CCACVL1_19741 [Corchorus capsula... 52 5e-06 OMO49712.1 hypothetical protein COLO4_38439 [Corchorus olitorius] 52 5e-06 GAV71114.1 hypothetical protein CFOL_v3_14608 [Cephalotus follic... 52 7e-06 XP_012087444.1 PREDICTED: uncharacterized protein LOC105646237 [... 52 7e-06 >KHG19725.1 Protein THEMIS2 [Gossypium arboreum] Length = 152 Score = 54.3 bits (129), Expect = 9e-07 Identities = 31/69 (44%), Positives = 36/69 (52%) Frame = +2 Query: 146 MGFLFRMQIHFVTYQREXXXXXXXXXXXXKSMXXXXXXXXXLTVSNHEDAESGEEEKIPM 325 MGF F+ +I+F +Q SM L VSNH DA +GEEEKIP Sbjct: 1 MGFFFKTEINFGLFQ---------------SMGRGRGKGKKLAVSNHNDAGNGEEEKIPS 45 Query: 326 QKRRGRPHK 352 QKRRGRP K Sbjct: 46 QKRRGRPQK 54 >KDP25141.1 hypothetical protein JCGZ_22676 [Jatropha curcas] Length = 165 Score = 54.3 bits (129), Expect = 1e-06 Identities = 34/69 (49%), Positives = 34/69 (49%) Frame = +2 Query: 146 MGFLFRMQIHFVTYQREXXXXXXXXXXXXKSMXXXXXXXXXLTVSNHEDAESGEEEKIPM 325 MG L RMQI F Q M LTVSNHED SGEEEKIP Sbjct: 1 MGLLLRMQISFFQNQ---FFCDLGCCLSGYFMGRGRGKGKKLTVSNHEDPGSGEEEKIPA 57 Query: 326 QKRRGRPHK 352 QKRRGRP K Sbjct: 58 QKRRGRPQK 66 >XP_007014877.1 PREDICTED: anoctamin-8 [Theobroma cacao] EOY32496.1 Uncharacterized protein TCM_040452 [Theobroma cacao] Length = 137 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTVSNHEDA SGEEEKIP QKRRGRP K Sbjct: 11 LTVSNHEDAGSGEEEKIPAQKRRGRPQK 38 >AFK42282.1 unknown [Lotus japonicus] Length = 74 Score = 51.2 bits (121), Expect = 3e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTV++HEDA SGE+EK+PMQKRRGRP K Sbjct: 11 LTVTSHEDAVSGEDEKVPMQKRRGRPQK 38 >XP_006445959.1 hypothetical protein CICLE_v10017123mg [Citrus clementina] XP_006494276.1 PREDICTED: uncharacterized protein LOC102626868 [Citrus sinensis] ESR59199.1 hypothetical protein CICLE_v10017123mg [Citrus clementina] KDO56499.1 hypothetical protein CISIN_1g047015mg [Citrus sinensis] Length = 137 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTVSNH+DA SGEEEKIP QKRRGRP K Sbjct: 11 LTVSNHDDAGSGEEEKIPAQKRRGRPQK 38 >OMO68964.1 hypothetical protein CCACVL1_19741 [Corchorus capsularis] Length = 137 Score = 52.0 bits (123), Expect = 5e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTVSNHED SGEEEKIP QKRRGRP K Sbjct: 11 LTVSNHEDTGSGEEEKIPAQKRRGRPQK 38 >OMO49712.1 hypothetical protein COLO4_38439 [Corchorus olitorius] Length = 137 Score = 52.0 bits (123), Expect = 5e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTVSNHED SGEEEKIP QKRRGRP K Sbjct: 11 LTVSNHEDTGSGEEEKIPAQKRRGRPQK 38 >GAV71114.1 hypothetical protein CFOL_v3_14608 [Cephalotus follicularis] Length = 137 Score = 51.6 bits (122), Expect = 7e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTVSNHED SGEEEKIP QKRRGRP K Sbjct: 11 LTVSNHEDPGSGEEEKIPAQKRRGRPQK 38 >XP_012087444.1 PREDICTED: uncharacterized protein LOC105646237 [Jatropha curcas] Length = 137 Score = 51.6 bits (122), Expect = 7e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 269 LTVSNHEDAESGEEEKIPMQKRRGRPHK 352 LTVSNHED SGEEEKIP QKRRGRP K Sbjct: 11 LTVSNHEDPGSGEEEKIPAQKRRGRPQK 38