BLASTX nr result
ID: Phellodendron21_contig00011065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00011065 (480 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410123.1 hypothetical protein MELLADRAFT_116486 [Melampsor... 61 8e-08 >XP_007410123.1 hypothetical protein MELLADRAFT_116486 [Melampsora larici-populina 98AG31] EGG06683.1 hypothetical protein MELLADRAFT_116486 [Melampsora larici-populina 98AG31] Length = 1864 Score = 60.8 bits (146), Expect = 8e-08 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +1 Query: 25 VSLLRGARNDPRMSAVSLLKPGSSIFGDRPSSSAGTDPTMSDYTKLETVIDGN 183 ++LL+ RN+PR SAVSLL+PGSSIF S + TD T D+TKLETVIDGN Sbjct: 1562 ITLLK-QRNNPRTSAVSLLRPGSSIFDRDRSITTSTDLTTPDHTKLETVIDGN 1613