BLASTX nr result
ID: Phellodendron21_contig00010709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00010709 (534 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP03532.1 unnamed protein product [Coffea canephora] 113 1e-26 XP_006479892.1 PREDICTED: peptide chain release factor APG3, chl... 113 2e-26 XP_006444254.1 hypothetical protein CICLE_v10023263mg [Citrus cl... 113 2e-26 OAY61779.1 hypothetical protein MANES_01G215500 [Manihot esculenta] 112 4e-26 XP_016737960.1 PREDICTED: peptide chain release factor APG3, chl... 112 5e-26 XP_017623999.1 PREDICTED: peptide chain release factor APG3, chl... 112 5e-26 XP_016737950.1 PREDICTED: peptide chain release factor APG3, chl... 112 5e-26 AFK34285.1 unknown [Lotus japonicus] 107 6e-26 KJB24351.1 hypothetical protein B456_004G141200 [Gossypium raimo... 110 9e-26 XP_015871375.1 PREDICTED: peptide chain release factor APG3, chl... 107 1e-25 XP_002269884.1 PREDICTED: peptide chain release factor APG3, chl... 110 1e-25 ONK78657.1 uncharacterized protein A4U43_C02F21090 [Asparagus of... 110 2e-25 XP_011079725.1 PREDICTED: peptide chain release factor APG3, chl... 110 2e-25 OMP06653.1 Peptide chain release factor class I/class II [Corcho... 110 2e-25 OMO63752.1 Peptide chain release factor class I/class II [Corcho... 110 2e-25 XP_012474946.1 PREDICTED: peptide chain release factor APG3, chl... 110 2e-25 XP_007050817.2 PREDICTED: peptide chain release factor APG3, chl... 110 3e-25 XP_011033587.1 PREDICTED: peptide chain release factor APG3, chl... 110 3e-25 EOX94974.1 Peptide chain release factor 1 isoform 2 [Theobroma c... 110 3e-25 XP_011079724.1 PREDICTED: peptide chain release factor APG3, chl... 110 3e-25 >CDP03532.1 unnamed protein product [Coffea canephora] Length = 423 Score = 113 bits (283), Expect = 1e-26 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE+IRNQR SQVGTGARAEKIRTYNYK Sbjct: 314 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQESIRNQRKSQVGTGARAEKIRTYNYK 372 >XP_006479892.1 PREDICTED: peptide chain release factor APG3, chloroplastic [Citrus sinensis] Length = 416 Score = 113 bits (282), Expect = 2e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IR QRLSQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQEKIRTQRLSQVGTGARAEKIRTYNYK 365 >XP_006444254.1 hypothetical protein CICLE_v10023263mg [Citrus clementina] ESR57494.1 hypothetical protein CICLE_v10023263mg [Citrus clementina] KDO87365.1 hypothetical protein CISIN_1g014874mg [Citrus sinensis] Length = 416 Score = 113 bits (282), Expect = 2e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IR QRLSQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQEKIRTQRLSQVGTGARAEKIRTYNYK 365 >OAY61779.1 hypothetical protein MANES_01G215500 [Manihot esculenta] Length = 420 Score = 112 bits (280), Expect = 4e-26 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNK+RALQLLRAKLYEIKVREQQE+IRNQR SQVGTGARAEKIRTYNYK Sbjct: 311 IFCTEERTQLQNKARALQLLRAKLYEIKVREQQESIRNQRKSQVGTGARAEKIRTYNYK 369 >XP_016737960.1 PREDICTED: peptide chain release factor APG3, chloroplastic isoform X3 [Gossypium hirsutum] Length = 411 Score = 112 bits (279), Expect = 5e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IRNQR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQELIRNQRKSQVGTGARAEKIRTYNYK 365 >XP_017623999.1 PREDICTED: peptide chain release factor APG3, chloroplastic [Gossypium arboreum] Length = 416 Score = 112 bits (279), Expect = 5e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IRNQR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQELIRNQRKSQVGTGARAEKIRTYNYK 365 >XP_016737950.1 PREDICTED: peptide chain release factor APG3, chloroplastic isoform X1 [Gossypium hirsutum] XP_016737955.1 PREDICTED: peptide chain release factor APG3, chloroplastic isoform X2 [Gossypium hirsutum] Length = 416 Score = 112 bits (279), Expect = 5e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IRNQR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQELIRNQRKSQVGTGARAEKIRTYNYK 365 >AFK34285.1 unknown [Lotus japonicus] Length = 200 Score = 107 bits (267), Expect = 6e-26 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQL+NK RALQLLRAKLYEIK+REQQE+IRN+R SQ+GTGARAEKIRTYNYK Sbjct: 91 IFCTEERTQLRNKHRALQLLRAKLYEIKLREQQESIRNERKSQIGTGARAEKIRTYNYK 149 >KJB24351.1 hypothetical protein B456_004G141200 [Gossypium raimondii] Length = 361 Score = 110 bits (275), Expect = 9e-26 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IRN+R SQVGTGARAEKIRTYNYK Sbjct: 252 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQELIRNRRKSQVGTGARAEKIRTYNYK 310 >XP_015871375.1 PREDICTED: peptide chain release factor APG3, chloroplastic-like, partial [Ziziphus jujuba] Length = 248 Score = 107 bits (268), Expect = 1e-25 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQN++RALQLLRAKLYEIK+REQQE+IRNQR QVGTGARAEKIRTYNYK Sbjct: 139 IFCTEERTQLQNRTRALQLLRAKLYEIKMREQQESIRNQRKLQVGTGARAEKIRTYNYK 197 >XP_002269884.1 PREDICTED: peptide chain release factor APG3, chloroplastic [Vitis vinifera] CBI32252.3 unnamed protein product, partial [Vitis vinifera] Length = 411 Score = 110 bits (276), Expect = 1e-25 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQN+SRALQLLRAKLYEIKVREQQE IRNQR SQVGTGARAEKIRTYNYK Sbjct: 302 IFCTEERTQLQNRSRALQLLRAKLYEIKVREQQELIRNQRKSQVGTGARAEKIRTYNYK 360 >ONK78657.1 uncharacterized protein A4U43_C02F21090 [Asparagus officinalis] Length = 403 Score = 110 bits (275), Expect = 2e-25 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQ+QNKSRALQLLRAKLYE+K+REQQE+IRNQR SQVGTGARAEKIRTYNYK Sbjct: 294 IFCTEERTQIQNKSRALQLLRAKLYEMKLREQQESIRNQRKSQVGTGARAEKIRTYNYK 352 >XP_011079725.1 PREDICTED: peptide chain release factor APG3, chloroplastic isoform X2 [Sesamum indicum] Length = 414 Score = 110 bits (275), Expect = 2e-25 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE +RNQR QVGTGARAEKIRTYNYK Sbjct: 305 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQEKLRNQRKMQVGTGARAEKIRTYNYK 363 >OMP06653.1 Peptide chain release factor class I/class II [Corchorus olitorius] Length = 416 Score = 110 bits (275), Expect = 2e-25 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNK+RA QLLRAKLYEIKVREQQE IRNQR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKNRAFQLLRAKLYEIKVREQQEQIRNQRKSQVGTGARAEKIRTYNYK 365 >OMO63752.1 Peptide chain release factor class I/class II [Corchorus capsularis] Length = 416 Score = 110 bits (275), Expect = 2e-25 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNK+RA QLLRAKLYEIKVREQQE IRNQR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKNRAFQLLRAKLYEIKVREQQEQIRNQRKSQVGTGARAEKIRTYNYK 365 >XP_012474946.1 PREDICTED: peptide chain release factor APG3, chloroplastic [Gossypium raimondii] KJB24348.1 hypothetical protein B456_004G141200 [Gossypium raimondii] Length = 416 Score = 110 bits (275), Expect = 2e-25 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE IRN+R SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQELIRNRRKSQVGTGARAEKIRTYNYK 365 >XP_007050817.2 PREDICTED: peptide chain release factor APG3, chloroplastic [Theobroma cacao] Length = 416 Score = 110 bits (274), Expect = 3e-25 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNK+RALQLLRAKLYEIKVREQQE IR+QR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKNRALQLLRAKLYEIKVREQQEQIRSQRKSQVGTGARAEKIRTYNYK 365 >XP_011033587.1 PREDICTED: peptide chain release factor APG3, chloroplastic [Populus euphratica] Length = 416 Score = 110 bits (274), Expect = 3e-25 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNK+RALQLLRAKLYEIK+REQQE+IRNQR QVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKNRALQLLRAKLYEIKIREQQESIRNQRKMQVGTGARAEKIRTYNYK 365 >EOX94974.1 Peptide chain release factor 1 isoform 2 [Theobroma cacao] Length = 416 Score = 110 bits (274), Expect = 3e-25 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNK+RALQLLRAKLYEIKVREQQE IR+QR SQVGTGARAEKIRTYNYK Sbjct: 307 IFCTEERTQLQNKNRALQLLRAKLYEIKVREQQEQIRSQRKSQVGTGARAEKIRTYNYK 365 >XP_011079724.1 PREDICTED: peptide chain release factor APG3, chloroplastic isoform X1 [Sesamum indicum] Length = 451 Score = 110 bits (275), Expect = 3e-25 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 533 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQENIRNQRLSQVGTGARAEKIRTYNYK 357 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQE +RNQR QVGTGARAEKIRTYNYK Sbjct: 305 IFCTEERTQLQNKSRALQLLRAKLYEIKVREQQEKLRNQRKMQVGTGARAEKIRTYNYK 363