BLASTX nr result
ID: Phellodendron21_contig00010652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00010652 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006425132.1 hypothetical protein CICLE_v10029177mg [Citrus cl... 73 1e-12 KDO66986.1 hypothetical protein CISIN_1g026069mg [Citrus sinensis] 72 2e-12 XP_010557194.1 PREDICTED: gamma-interferon-inducible lysosomal t... 72 3e-12 XP_013722016.1 PREDICTED: gamma-interferon-inducible lysosomal t... 71 6e-12 CDY06674.1 BnaA10g04530D [Brassica napus] 71 6e-12 XP_013639124.1 PREDICTED: gamma-interferon-inducible lysosomal t... 70 8e-12 XP_006488571.1 PREDICTED: gamma-interferon-inducible lysosomal t... 70 9e-12 XP_013694290.1 PREDICTED: gamma-interferon-inducible lysosomal t... 70 1e-11 AAF82212.1 Contains similarity to an unknown protein F7A7_100 gi... 70 1e-11 NP_563779.1 Thioredoxin superfamily protein [Arabidopsis thalian... 70 1e-11 JAV00478.1 Gamma-interferon-inducible lysosomal thiol reductase ... 70 1e-11 XP_002889632.1 hypothetical protein ARALYDRAFT_470730 [Arabidops... 70 1e-11 JAU40111.1 Gamma-interferon-inducible lysosomal thiol reductase ... 70 1e-11 JAU24660.1 Gamma-interferon-inducible lysosomal thiol reductase ... 70 1e-11 OAP19430.1 hypothetical protein AXX17_AT1G06710 [Arabidopsis tha... 70 1e-11 CDY10246.1 BnaC05g04890D [Brassica napus] 70 2e-11 JAU64937.1 Gamma-interferon-inducible lysosomal thiol reductase,... 70 2e-11 KFK43003.1 hypothetical protein AALP_AA1G067000 [Arabis alpina] 70 2e-11 XP_007016964.2 PREDICTED: gamma-interferon-inducible lysosomal t... 69 3e-11 EOY34583.1 Thioredoxin superfamily protein isoform 1 [Theobroma ... 69 3e-11 >XP_006425132.1 hypothetical protein CICLE_v10029177mg [Citrus clementina] ESR38372.1 hypothetical protein CICLE_v10029177mg [Citrus clementina] Length = 243 Score = 72.8 bits (177), Expect = 1e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTYPL 112 VVVDGQPLYEDYENF+SYICKAYKGN VPKACS L Sbjct: 188 VVVDGQPLYEDYENFVSYICKAYKGNVVPKACSNLSL 224 >KDO66986.1 hypothetical protein CISIN_1g026069mg [Citrus sinensis] Length = 244 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACS 100 VVVDGQPLYEDYENFISY+CKAYKGN VPKACS Sbjct: 189 VVVDGQPLYEDYENFISYVCKAYKGNVVPKACS 221 >XP_010557194.1 PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Tarenaya hassleriana] Length = 279 Score = 72.4 bits (176), Expect = 3e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGNAVP AC+ Y Sbjct: 194 VVVDGQPLYEDYENFISYICKAYKGNAVPGACAKY 228 >XP_013722016.1 PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Brassica napus] Length = 260 Score = 71.2 bits (173), Expect = 6e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 185 VVVDGQPLYEDYENFISYICKAYKGNKVPSACAKY 219 >CDY06674.1 BnaA10g04530D [Brassica napus] Length = 260 Score = 71.2 bits (173), Expect = 6e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 185 VVVDGQPLYEDYENFISYICKAYKGNKVPSACAKY 219 >XP_013639124.1 PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Brassica oleracea var. oleracea] Length = 235 Score = 70.5 bits (171), Expect = 8e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 158 VVVDGQPLYEDYENFISYICKAYKGNEVPGACAKY 192 >XP_006488571.1 PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Citrus sinensis] Length = 244 Score = 70.5 bits (171), Expect = 9e-12 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACS 100 VVV+GQPLYEDYENFISY+CKAYKGN VPKACS Sbjct: 189 VVVEGQPLYEDYENFISYVCKAYKGNVVPKACS 221 >XP_013694290.1 PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Brassica napus] Length = 231 Score = 70.1 bits (170), Expect = 1e-11 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC Y Sbjct: 160 VVVDGQPLYEDYENFISYICKAYKGNKVPGACDKY 194 >AAF82212.1 Contains similarity to an unknown protein F7A7_100 gi|7327817 from Arabidopsis thaliana BAC F7A7 gb|AL161946. ESTs gb|N65842, gb|F19836 and gb|AI993679 come from this gene [Arabidopsis thaliana] Length = 262 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 182 VVVDGQPLYEDYENFISYICKAYKGNKVPGACTKY 216 >NP_563779.1 Thioredoxin superfamily protein [Arabidopsis thaliana] AAK83650.1 At1g07080/F10K1_15 [Arabidopsis thaliana] AAL06806.1 At1g07080/F10K1_15 [Arabidopsis thaliana] AEE28075.1 Thioredoxin superfamily protein [Arabidopsis thaliana] Length = 265 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 185 VVVDGQPLYEDYENFISYICKAYKGNKVPGACTKY 219 >JAV00478.1 Gamma-interferon-inducible lysosomal thiol reductase [Noccaea caerulescens] Length = 266 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTYPLSPTT 124 VVVDGQPLYEDYENFISYICKAYKGN P AC+ Y T+ Sbjct: 187 VVVDGQPLYEDYENFISYICKAYKGNKAPSACAKYTSGKTS 227 >XP_002889632.1 hypothetical protein ARALYDRAFT_470730 [Arabidopsis lyrata subsp. lyrata] EFH65891.1 hypothetical protein ARALYDRAFT_470730 [Arabidopsis lyrata subsp. lyrata] Length = 268 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 188 VVVDGQPLYEDYENFISYICKAYKGNKVPGACAKY 222 >JAU40111.1 Gamma-interferon-inducible lysosomal thiol reductase [Noccaea caerulescens] Length = 269 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTYPLSPTT 124 VVVDGQPLYEDYENFISYICKAYKGN P AC+ Y T+ Sbjct: 190 VVVDGQPLYEDYENFISYICKAYKGNKAPSACAKYTSGKTS 230 >JAU24660.1 Gamma-interferon-inducible lysosomal thiol reductase [Noccaea caerulescens] Length = 269 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTYPLSPTT 124 VVVDGQPLYEDYENFISYICKAYKGN P AC+ Y T+ Sbjct: 190 VVVDGQPLYEDYENFISYICKAYKGNKTPSACAKYTSGKTS 230 >OAP19430.1 hypothetical protein AXX17_AT1G06710 [Arabidopsis thaliana] Length = 276 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 196 VVVDGQPLYEDYENFISYICKAYKGNKVPGACTKY 230 >CDY10246.1 BnaC05g04890D [Brassica napus] Length = 294 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN VP AC+ Y Sbjct: 217 VVVDGQPLYEDYENFISYICKAYKGNEVPGACAKY 251 >JAU64937.1 Gamma-interferon-inducible lysosomal thiol reductase, partial [Noccaea caerulescens] Length = 298 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTYPLSPTT 124 VVVDGQPLYEDYENFISYICKAYKGN P AC+ Y T+ Sbjct: 219 VVVDGQPLYEDYENFISYICKAYKGNKAPSACAKYTSGKTS 259 >KFK43003.1 hypothetical protein AALP_AA1G067000 [Arabis alpina] Length = 259 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACSTY 106 VVVDGQPLYEDYENFISYICKAYKGN P AC+ Y Sbjct: 180 VVVDGQPLYEDYENFISYICKAYKGNKTPSACAKY 214 >XP_007016964.2 PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Theobroma cacao] Length = 259 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACS 100 VVVDGQPLYEDYEN+ISY+CKAYKG AVPKACS Sbjct: 182 VVVDGQPLYEDYENYISYVCKAYKGAAVPKACS 214 >EOY34583.1 Thioredoxin superfamily protein isoform 1 [Theobroma cacao] Length = 259 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 2 VVVDGQPLYEDYENFISYICKAYKGNAVPKACS 100 VVVDGQPLYEDYEN+ISY+CKAYKG AVPKACS Sbjct: 182 VVVDGQPLYEDYENYISYVCKAYKGAAVPKACS 214