BLASTX nr result
ID: Phellodendron21_contig00010293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00010293 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP02651.1 hypothetical protein COLO4_10932 [Corchorus olitorius] 60 1e-09 OMO58838.1 hypothetical protein CCACVL1_25319 [Corchorus capsula... 59 3e-09 KJB73689.1 hypothetical protein B456_011G243800 [Gossypium raimo... 59 1e-08 OMO89862.1 hypothetical protein CCACVL1_07590 [Corchorus capsula... 57 2e-08 OMO58839.1 hypothetical protein CCACVL1_25320, partial [Corchoru... 56 4e-08 OMP02649.1 monocarboxylate transporter 9 [Corchorus olitorius] 56 1e-07 OMO60418.1 hypothetical protein CCACVL1_24180 [Corchorus capsula... 54 2e-07 KHG26645.1 Violaxanthin de-epoxidase, chloroplastic [Gossypium a... 57 1e-06 CAN64497.1 hypothetical protein VITISV_004037 [Vitis vinifera] 56 2e-06 OMO81422.1 hypothetical protein COLO4_23610 [Corchorus olitorius] 51 3e-06 >OMP02651.1 hypothetical protein COLO4_10932 [Corchorus olitorius] Length = 45 Score = 60.1 bits (144), Expect = 1e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCFLVN 324 VSTERTILSPFTKEYRVLAA+SGIRLFLE FL N Sbjct: 11 VSTERTILSPFTKEYRVLAAQSGIRLFLECWFLWN 45 >OMO58838.1 hypothetical protein CCACVL1_25319 [Corchorus capsularis] Length = 50 Score = 58.9 bits (141), Expect = 3e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCFLVN 324 VSTERTILSPFTKEYRVLAA SGIRLFL G F+++ Sbjct: 9 VSTERTILSPFTKEYRVLAASSGIRLFLGGLFVLD 43 >KJB73689.1 hypothetical protein B456_011G243800 [Gossypium raimondii] Length = 129 Score = 59.3 bits (142), Expect = 1e-08 Identities = 37/67 (55%), Positives = 44/67 (65%), Gaps = 4/67 (5%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCFLV-NAPIKAKIIFFFG---VLSLRV*LL 261 VSTERTILSPFTKEYRVLAA SGIRLFLE FL N P + + F +L+ L Sbjct: 60 VSTERTILSPFTKEYRVLAAYSGIRLFLEAYFLFRNGPSSSSSKYSFDGDPLLAANTASL 119 Query: 260 LTAADSI 240 L +D++ Sbjct: 120 LEISDNV 126 >OMO89862.1 hypothetical protein CCACVL1_07590 [Corchorus capsularis] Length = 59 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCF 333 VSTERTILSPFTKEYRVLAA SGIRLFL G F Sbjct: 11 VSTERTILSPFTKEYRVLAAHSGIRLFLGGPF 42 >OMO58839.1 hypothetical protein CCACVL1_25320, partial [Corchorus capsularis] Length = 58 Score = 56.2 bits (134), Expect = 4e-08 Identities = 33/47 (70%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCF-LVNAPIKAKIIFFF 291 VSTERTILSPFTKEYRVLAA SGIRLFL G F L P FF+ Sbjct: 9 VSTERTILSPFTKEYRVLAALSGIRLFLGGPFPLGTGPTITSAKFFW 55 >OMP02649.1 monocarboxylate transporter 9 [Corchorus olitorius] Length = 81 Score = 55.8 bits (133), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCF 333 VSTERTILSPFTKEYRVLAA SGIRLFL G F Sbjct: 9 VSTERTILSPFTKEYRVLAALSGIRLFLGGPF 40 >OMO60418.1 hypothetical protein CCACVL1_24180 [Corchorus capsularis] Length = 32 Score = 53.9 bits (128), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCF 333 +STERTILSPFTKEYRVL A SGIRLFLE F Sbjct: 1 MSTERTILSPFTKEYRVLVAGSGIRLFLEELF 32 >KHG26645.1 Violaxanthin de-epoxidase, chloroplastic [Gossypium arboreum] Length = 578 Score = 57.0 bits (136), Expect = 1e-06 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 310 ALMGAFTKKHPSKNRRMPLSAASTRYSLVKGERIVRSVL 426 +L+ AF + PSKNRRMPL AASTRYSLVKGERIVR VL Sbjct: 514 SLIEAFHIEPPSKNRRMPLRAASTRYSLVKGERIVRFVL 552 >CAN64497.1 hypothetical protein VITISV_004037 [Vitis vinifera] Length = 480 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCFLVNAP 318 VST+RTILSPFTKEYRV AA SGIRLFLEG ++ P Sbjct: 20 VSTKRTILSPFTKEYRVRAASSGIRLFLEGASSLDDP 56 >OMO81422.1 hypothetical protein COLO4_23610 [Corchorus olitorius] Length = 32 Score = 50.8 bits (120), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 428 VSTERTILSPFTKEYRVLAAESGIRLFLEGCF 333 +STERTILSPFT EYRVL A+SGIRLFL F Sbjct: 1 MSTERTILSPFTNEYRVLVADSGIRLFLGELF 32