BLASTX nr result
ID: Phellodendron21_contig00009683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00009683 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010060040.1 PREDICTED: 40S ribosomal protein S6-2 [Eucalyptus... 91 4e-20 XP_009758302.1 PREDICTED: 40S ribosomal protein S6-like [Nicotia... 91 6e-20 XP_019425273.1 PREDICTED: 40S ribosomal protein S6-2-like [Lupin... 87 7e-20 EEF36525.1 40S ribosomal protein S6, putative [Ricinus communis] 89 9e-20 XP_006355210.1 PREDICTED: 40S ribosomal protein S6-like [Solanum... 89 9e-20 KDO48241.1 hypothetical protein CISIN_1g025591mg [Citrus sinensis] 89 1e-19 XP_018848971.1 PREDICTED: 40S ribosomal protein S6-like, partial... 88 2e-19 XP_012067901.1 PREDICTED: 40S ribosomal protein S6-like [Jatroph... 89 2e-19 XP_019230741.1 PREDICTED: 40S ribosomal protein S6-like [Nicotia... 89 2e-19 XP_016550131.1 PREDICTED: 40S ribosomal protein S6 [Capsicum ann... 89 2e-19 XP_016549553.1 PREDICTED: 40S ribosomal protein S6-like [Capsicu... 89 2e-19 XP_016454823.1 PREDICTED: 40S ribosomal protein S6-like [Nicotia... 89 2e-19 XP_002525831.2 PREDICTED: 40S ribosomal protein S6 [Ricinus comm... 89 2e-19 NP_001275029.1 40S ribosomal protein S6-like [Solanum tuberosum]... 89 2e-19 NP_001274954.1 40S ribosomal protein S6-1-like [Solanum tuberosu... 89 2e-19 NP_001333800.1 40S ribosomal protein S6 [Solanum lycopersicum] X... 89 2e-19 XP_004246081.1 PREDICTED: 40S ribosomal protein S6 [Solanum lyco... 89 2e-19 XP_004244462.1 PREDICTED: 40S ribosomal protein S6 [Solanum lyco... 89 2e-19 KZV24121.1 hypothetical protein F511_41364 [Dorcoceras hygrometr... 87 3e-19 KVI08599.1 Ribosomal protein S6e [Cynara cardunculus var. scolymus] 88 3e-19 >XP_010060040.1 PREDICTED: 40S ribosomal protein S6-2 [Eucalyptus grandis] KCW66569.1 hypothetical protein EUGRSUZ_F00368 [Eucalyptus grandis] Length = 249 Score = 90.9 bits (224), Expect = 4e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >XP_009758302.1 PREDICTED: 40S ribosomal protein S6-like [Nicotiana sylvestris] XP_016457397.1 PREDICTED: 40S ribosomal protein S6-like [Nicotiana tabacum] XP_019254214.1 PREDICTED: 40S ribosomal protein S6-like [Nicotiana attenuata] OIS97531.1 40s ribosomal protein s6-2 [Nicotiana attenuata] Length = 249 Score = 90.5 bits (223), Expect = 6e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_019425273.1 PREDICTED: 40S ribosomal protein S6-2-like [Lupinus angustifolius] Length = 116 Score = 87.0 bits (214), Expect = 7e-20 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKSDAADYQKLLA+RLKEQRERRSESLAKKRSRLS+A+KPS A Sbjct: 67 KKRIAKAKSDAADYQKLLASRLKEQRERRSESLAKKRSRLSSATKPSATA 116 >EEF36525.1 40S ribosomal protein S6, putative [Ricinus communis] Length = 197 Score = 89.0 bits (219), Expect = 9e-20 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 K+RIAKAKS+AADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 148 KQRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 197 >XP_006355210.1 PREDICTED: 40S ribosomal protein S6-like [Solanum tuberosum] Length = 197 Score = 89.0 bits (219), Expect = 9e-20 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 148 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 197 >KDO48241.1 hypothetical protein CISIN_1g025591mg [Citrus sinensis] Length = 198 Score = 88.6 bits (218), Expect = 1e-19 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 K+RIAKAK++AA+YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA Sbjct: 148 KQRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 197 >XP_018848971.1 PREDICTED: 40S ribosomal protein S6-like, partial [Juglans regia] Length = 177 Score = 87.8 bits (216), Expect = 2e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AA+YQKLLATRLKEQR+RRSESLAKKRSRLSAASKPS AA Sbjct: 128 KKRIAKAKSEAAEYQKLLATRLKEQRDRRSESLAKKRSRLSAASKPSIAA 177 >XP_012067901.1 PREDICTED: 40S ribosomal protein S6-like [Jatropha curcas] KDP41410.1 hypothetical protein JCGZ_15817 [Jatropha curcas] Length = 249 Score = 89.4 bits (220), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AA+YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 >XP_019230741.1 PREDICTED: 40S ribosomal protein S6-like [Nicotiana attenuata] OIT29213.1 40s ribosomal protein s6-1 [Nicotiana attenuata] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AA+YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_016550131.1 PREDICTED: 40S ribosomal protein S6 [Capsicum annuum] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AA+YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_016549553.1 PREDICTED: 40S ribosomal protein S6-like [Capsicum annuum] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_016454823.1 PREDICTED: 40S ribosomal protein S6-like [Nicotiana tabacum] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AA+YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_002525831.2 PREDICTED: 40S ribosomal protein S6 [Ricinus communis] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 K+RIAKAKS+AADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KQRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >NP_001275029.1 40S ribosomal protein S6-like [Solanum tuberosum] ABB87117.1 unknown [Solanum tuberosum] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >NP_001274954.1 40S ribosomal protein S6-1-like [Solanum tuberosum] ABA40470.1 ribosomal protein S6-like protein [Solanum tuberosum] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >NP_001333800.1 40S ribosomal protein S6 [Solanum lycopersicum] XP_015061494.1 PREDICTED: 40S ribosomal protein S6 [Solanum pennellii] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_004246081.1 PREDICTED: 40S ribosomal protein S6 [Solanum lycopersicum] XP_015085514.1 PREDICTED: 40S ribosomal protein S6-like [Solanum pennellii] XP_015085571.1 PREDICTED: 40S ribosomal protein S6-like [Solanum pennellii] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >XP_004244462.1 PREDICTED: 40S ribosomal protein S6 [Solanum lycopersicum] Length = 249 Score = 89.0 bits (219), Expect = 2e-19 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 200 KKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 >KZV24121.1 hypothetical protein F511_41364 [Dorcoceras hygrometricum] Length = 197 Score = 87.4 bits (215), Expect = 3e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AA+YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS A Sbjct: 148 KKRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIVA 197 >KVI08599.1 Ribosomal protein S6e [Cynara cardunculus var. scolymus] Length = 214 Score = 87.8 bits (216), Expect = 3e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +3 Query: 3 KKRIAKAKSDAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 152 KKRIAKAKS+AADYQKLLA+RLKEQRE+RSESLAKKRSRLSAASKPS AA Sbjct: 165 KKRIAKAKSEAADYQKLLASRLKEQREKRSESLAKKRSRLSAASKPSIAA 214