BLASTX nr result
ID: Phellodendron21_contig00009148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00009148 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO83210.1 hypothetical protein CISIN_1g003146mg [Citrus sinensis] 68 5e-11 XP_006482990.1 PREDICTED: U-box domain-containing protein 44-lik... 68 5e-11 XP_006438883.1 hypothetical protein CICLE_v10030698mg [Citrus cl... 68 5e-11 >KDO83210.1 hypothetical protein CISIN_1g003146mg [Citrus sinensis] Length = 844 Score = 67.8 bits (164), Expect = 5e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +2 Query: 110 LDFALLELRELISAKTVGSERMNKEEIISVLLNRFGSSKPYNLLI 244 L FALLELRELISAKTV SE +N+ EII+VLLNR GSSKPYN LI Sbjct: 200 LKFALLELRELISAKTVDSEWINEAEIIAVLLNRLGSSKPYNRLI 244 >XP_006482990.1 PREDICTED: U-box domain-containing protein 44-like [Citrus sinensis] Length = 844 Score = 67.8 bits (164), Expect = 5e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +2 Query: 110 LDFALLELRELISAKTVGSERMNKEEIISVLLNRFGSSKPYNLLI 244 L FALLELRELISAKTV SE +N+ EII+VLLNR GSSKPYN LI Sbjct: 200 LKFALLELRELISAKTVDSEWINEAEIIAVLLNRLGSSKPYNRLI 244 >XP_006438883.1 hypothetical protein CICLE_v10030698mg [Citrus clementina] ESR52123.1 hypothetical protein CICLE_v10030698mg [Citrus clementina] Length = 844 Score = 67.8 bits (164), Expect = 5e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +2 Query: 110 LDFALLELRELISAKTVGSERMNKEEIISVLLNRFGSSKPYNLLI 244 L FALLELRELISAKTV SE +N+ EII+VLLNR GSSKPYN LI Sbjct: 200 LKFALLELRELISAKTVDSEWINEAEIIAVLLNRLGSSKPYNRLI 244