BLASTX nr result
ID: Phellodendron21_contig00008877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008877 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404981.1 hypothetical protein MELLADRAFT_102242 [Melampsor... 88 2e-19 >XP_007404981.1 hypothetical protein MELLADRAFT_102242 [Melampsora larici-populina 98AG31] EGG11346.1 hypothetical protein MELLADRAFT_102242 [Melampsora larici-populina 98AG31] Length = 215 Score = 87.8 bits (216), Expect = 2e-19 Identities = 44/69 (63%), Positives = 53/69 (76%), Gaps = 1/69 (1%) Frame = -3 Query: 204 KKRKTADEPSPEIMPVGTTARSLAAATA-EKHKKKDASETNHIDVVPSRPTFDFSALPPS 28 KKRKT +EPSPEI+P GTT RS+AAAT+ EK K K+ +E N SRPTFDF+ LP S Sbjct: 11 KKRKTNEEPSPEILPTGTTVRSIAAATSVEKTKTKETTEPNSNPSPLSRPTFDFTTLPSS 70 Query: 27 AIHRYLIFH 1 AIHRYL++H Sbjct: 71 AIHRYLLYH 79