BLASTX nr result
ID: Phellodendron21_contig00008707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008707 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019444292.1 PREDICTED: 60S ribosomal protein L24-like isoform... 71 4e-13 XP_007162832.1 hypothetical protein PHAVU_001G184700g [Phaseolus... 72 6e-13 XP_014495183.1 PREDICTED: 60S ribosomal protein L24 [Vigna radia... 72 6e-13 XP_010053326.1 PREDICTED: 60S ribosomal protein L24 [Eucalyptus ... 72 6e-13 KDO63542.1 hypothetical protein CISIN_1g031225mg [Citrus sinensis] 70 6e-13 XP_019444291.1 PREDICTED: 60S ribosomal protein L24-like isoform... 71 8e-13 XP_019419249.1 PREDICTED: 60S ribosomal protein L24 [Lupinus ang... 71 8e-13 XP_019432874.1 PREDICTED: 60S ribosomal protein L24-like [Lupinu... 71 8e-13 XP_019430123.1 PREDICTED: 60S ribosomal protein L24-like [Lupinu... 71 8e-13 XP_019440458.1 PREDICTED: 60S ribosomal protein L24-like [Lupinu... 71 8e-13 XP_019454462.1 PREDICTED: 60S ribosomal protein L24-like [Lupinu... 71 8e-13 XP_017255496.1 PREDICTED: 60S ribosomal protein L24 [Daucus caro... 71 8e-13 KZV36262.1 hypothetical protein F511_14280 [Dorcoceras hygrometr... 71 8e-13 XP_017249620.1 PREDICTED: 60S ribosomal protein L24-like [Daucus... 71 8e-13 XP_010662508.1 PREDICTED: 60S ribosomal protein L24 isoform X2 [... 71 8e-13 XP_008360701.1 PREDICTED: 60S ribosomal protein L24 [Malus domes... 71 8e-13 XP_008387472.1 PREDICTED: 60S ribosomal protein L24 [Malus domes... 71 8e-13 XP_012082538.1 PREDICTED: 60S ribosomal protein L24-like [Jatrop... 71 8e-13 XP_002279048.2 PREDICTED: 60S ribosomal protein L24 isoform X1 [... 71 8e-13 OMO83980.1 Ribosomal protein L24e-related protein [Corchorus oli... 71 8e-13 >XP_019444292.1 PREDICTED: 60S ribosomal protein L24-like isoform X2 [Lupinus angustifolius] Length = 132 Score = 71.2 bits (173), Expect = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_007162832.1 hypothetical protein PHAVU_001G184700g [Phaseolus vulgaris] ESW34826.1 hypothetical protein PHAVU_001G184700g [Phaseolus vulgaris] Length = 163 Score = 71.6 bits (174), Expect = 6e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 AAKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAAL Sbjct: 76 AAKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAAL 112 >XP_014495183.1 PREDICTED: 60S ribosomal protein L24 [Vigna radiata var. radiata] XP_017409960.1 PREDICTED: 60S ribosomal protein L24 [Vigna angularis] KOM29235.1 hypothetical protein LR48_Vigan641s002300 [Vigna angularis] BAT85796.1 hypothetical protein VIGAN_04338300 [Vigna angularis var. angularis] Length = 164 Score = 71.6 bits (174), Expect = 6e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 AAKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAAL Sbjct: 76 AAKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAAL 112 >XP_010053326.1 PREDICTED: 60S ribosomal protein L24 [Eucalyptus grandis] Length = 164 Score = 71.6 bits (174), Expect = 6e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 AAKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAAL Sbjct: 76 AAKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAAL 112 >KDO63542.1 hypothetical protein CISIN_1g031225mg [Citrus sinensis] Length = 108 Score = 70.1 bits (170), Expect = 6e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 + KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 21 STKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 57 >XP_019444291.1 PREDICTED: 60S ribosomal protein L24-like isoform X1 [Lupinus angustifolius] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_019419249.1 PREDICTED: 60S ribosomal protein L24 [Lupinus angustifolius] XP_019419250.1 PREDICTED: 60S ribosomal protein L24 [Lupinus angustifolius] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_019432874.1 PREDICTED: 60S ribosomal protein L24-like [Lupinus angustifolius] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_019430123.1 PREDICTED: 60S ribosomal protein L24-like [Lupinus angustifolius] OIW19950.1 hypothetical protein TanjilG_30884 [Lupinus angustifolius] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_019440458.1 PREDICTED: 60S ribosomal protein L24-like [Lupinus angustifolius] OIW13504.1 hypothetical protein TanjilG_29245 [Lupinus angustifolius] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_019454462.1 PREDICTED: 60S ribosomal protein L24-like [Lupinus angustifolius] OIW05126.1 hypothetical protein TanjilG_02599 [Lupinus angustifolius] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_017255496.1 PREDICTED: 60S ribosomal protein L24 [Daucus carota subsp. sativus] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >KZV36262.1 hypothetical protein F511_14280 [Dorcoceras hygrometricum] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 75 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 111 >XP_017249620.1 PREDICTED: 60S ribosomal protein L24-like [Daucus carota subsp. sativus] KZM94394.1 hypothetical protein DCAR_017637 [Daucus carota subsp. sativus] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_010662508.1 PREDICTED: 60S ribosomal protein L24 isoform X2 [Vitis vinifera] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 428 AKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 AKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 77 AKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_008360701.1 PREDICTED: 60S ribosomal protein L24 [Malus domestica] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_008387472.1 PREDICTED: 60S ribosomal protein L24 [Malus domestica] XP_009334890.1 PREDICTED: 60S ribosomal protein L24 [Pyrus x bretschneideri] XP_009340972.1 PREDICTED: 60S ribosomal protein L24 [Pyrus x bretschneideri] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_012082538.1 PREDICTED: 60S ribosomal protein L24-like [Jatropha curcas] KDP29235.1 hypothetical protein JCGZ_16624 [Jatropha curcas] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >XP_002279048.2 PREDICTED: 60S ribosomal protein L24 isoform X1 [Vitis vinifera] Length = 163 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 428 AKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 AKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 77 AKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112 >OMO83980.1 Ribosomal protein L24e-related protein [Corchorus olitorius] OMP06514.1 Ribosomal protein L24e-related protein [Corchorus capsularis] Length = 164 Score = 71.2 bits (173), Expect = 8e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 431 AAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 321 A KKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL Sbjct: 76 ATKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAAL 112