BLASTX nr result
ID: Phellodendron21_contig00008588
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008588 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006489690.1 PREDICTED: probable plastid-lipid-associated prot... 78 1e-14 AAR26477.1 harpin binding protein 1 [Citrus x paradisi] 72 1e-12 XP_006420279.1 hypothetical protein CICLE_v10007095mg [Citrus cl... 65 5e-10 >XP_006489690.1 PREDICTED: probable plastid-lipid-associated protein 6, chloroplastic [Citrus sinensis] Length = 326 Score = 77.8 bits (190), Expect = 1e-14 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 5/80 (6%) Frame = +1 Query: 91 QNQTSLKAFETHTMASLTLSSLFQSPAFISS--KTHTVTKTLSFQSPTRRRLLVNNDKQH 264 Q ++ TH MASLTL+ LF SP F+SS THTVTK LSF SPTRRRLLVN K++ Sbjct: 29 QTHADIETPPTHIMASLTLTPLFHSPTFLSSNTNTHTVTKKLSFPSPTRRRLLVNG-KEY 87 Query: 265 LS--RSLVL-RSAIDDVSVI 315 S RSLVL RSA+DDV V+ Sbjct: 88 RSRRRSLVLRRSAVDDVPVL 107 >AAR26477.1 harpin binding protein 1 [Citrus x paradisi] Length = 285 Score = 72.0 bits (175), Expect = 1e-12 Identities = 46/67 (68%), Positives = 52/67 (77%), Gaps = 5/67 (7%) Frame = +1 Query: 130 MASLTLSSLFQSPAFISSKT--HTVTKTLSFQSPTRRRLLVNNDKQHLS--RSLVL-RSA 294 MASLTL+ LF SP F+SS T HTVTK LSF SPTRRRLLVN K++ S RSLVL RSA Sbjct: 1 MASLTLTPLFHSPTFLSSNTNTHTVTKKLSFPSPTRRRLLVNG-KEYRSRRRSLVLRRSA 59 Query: 295 IDDVSVI 315 +DDV V+ Sbjct: 60 VDDVPVL 66 >XP_006420279.1 hypothetical protein CICLE_v10007095mg [Citrus clementina] ESR33519.1 hypothetical protein CICLE_v10007095mg [Citrus clementina] Length = 285 Score = 64.7 bits (156), Expect = 5e-10 Identities = 44/67 (65%), Positives = 50/67 (74%), Gaps = 5/67 (7%) Frame = +1 Query: 130 MASLTLSSLFQSPAFISSKTHT--VTKTLSFQSPTRRRLLVNNDKQHLS--RSLVL-RSA 294 MASLTL+ L SP +SS T T VTK LSFQSPTRRRLLVN K++ S RSLVL RSA Sbjct: 1 MASLTLTPLSHSPTSLSSNTSTQRVTKKLSFQSPTRRRLLVNG-KEYRSRRRSLVLRRSA 59 Query: 295 IDDVSVI 315 +DDV V+ Sbjct: 60 VDDVPVL 66