BLASTX nr result
ID: Phellodendron21_contig00008507
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008507 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO83808.1 hypothetical protein CISIN_1g031787mg [Citrus sinensis] 102 5e-26 KDO74585.1 hypothetical protein CISIN_1g031812mg [Citrus sinensis] 102 6e-26 OMO53454.1 Ribosomal protein S13 [Corchorus capsularis] 100 9e-26 XP_006434520.1 hypothetical protein CICLE_v10002764mg [Citrus cl... 102 1e-25 XP_006419931.1 hypothetical protein CICLE_v10006140mg [Citrus cl... 102 1e-25 KJB60026.1 hypothetical protein B456_009G286200 [Gossypium raimo... 100 2e-25 XP_012451709.1 PREDICTED: 40S ribosomal protein S18 isoform X2 [... 100 4e-25 KRX11609.1 40S ribosomal protein S18, partial [Trichinella nelsoni] 99 4e-25 KJB65871.1 hypothetical protein B456_010G132100 [Gossypium raimo... 100 5e-25 ONK74320.1 uncharacterized protein A4U43_C03F5030 [Asparagus off... 100 5e-25 OMO54133.1 Ribosomal protein S13 [Corchorus capsularis] OMO98639... 100 5e-25 XP_019464902.1 PREDICTED: 40S ribosomal protein S18-like [Lupinu... 100 5e-25 XP_019427792.1 PREDICTED: 40S ribosomal protein S18-like [Lupinu... 100 5e-25 XP_019435035.1 PREDICTED: 40S ribosomal protein S18-like isoform... 100 5e-25 XP_018846583.1 PREDICTED: 40S ribosomal protein S18 [Juglans regia] 100 5e-25 OAP12454.1 hypothetical protein AXX17_AT1G34840 [Arabidopsis tha... 100 5e-25 XP_015892092.1 PREDICTED: 40S ribosomal protein S18 [Ziziphus ju... 100 5e-25 NP_173692.1 Ribosomal protein S13/S18 family [Arabidopsis thalia... 100 5e-25 XP_010534126.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya ha... 100 5e-25 XP_010542963.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya ha... 100 5e-25 >KDO83808.1 hypothetical protein CISIN_1g031787mg [Citrus sinensis] Length = 118 Score = 102 bits (254), Expect = 5e-26 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >KDO74585.1 hypothetical protein CISIN_1g031812mg [Citrus sinensis] Length = 126 Score = 102 bits (254), Expect = 6e-26 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >OMO53454.1 Ribosomal protein S13 [Corchorus capsularis] Length = 89 Score = 100 bits (250), Expect = 9e-26 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >XP_006434520.1 hypothetical protein CICLE_v10002764mg [Citrus clementina] XP_006473109.1 PREDICTED: 40S ribosomal protein S18 [Citrus sinensis] ESR47760.1 hypothetical protein CICLE_v10002764mg [Citrus clementina] KDO83807.1 hypothetical protein CISIN_1g031787mg [Citrus sinensis] Length = 152 Score = 102 bits (254), Expect = 1e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >XP_006419931.1 hypothetical protein CICLE_v10006140mg [Citrus clementina] XP_006489386.1 PREDICTED: 40S ribosomal protein S18 [Citrus sinensis] ESR33171.1 hypothetical protein CICLE_v10006140mg [Citrus clementina] KDO74584.1 hypothetical protein CISIN_1g031812mg [Citrus sinensis] Length = 152 Score = 102 bits (254), Expect = 1e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >KJB60026.1 hypothetical protein B456_009G286200 [Gossypium raimondii] Length = 125 Score = 100 bits (250), Expect = 2e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >XP_012451709.1 PREDICTED: 40S ribosomal protein S18 isoform X2 [Gossypium raimondii] XP_016669620.1 PREDICTED: 40S ribosomal protein S18 isoform X2 [Gossypium hirsutum] KJB65872.1 hypothetical protein B456_010G132100 [Gossypium raimondii] Length = 145 Score = 100 bits (250), Expect = 4e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >KRX11609.1 40S ribosomal protein S18, partial [Trichinella nelsoni] Length = 70 Score = 98.6 bits (244), Expect = 4e-25 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANE+FQHILRV+NTNVDGKQKI+FALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEEFQHILRVMNTNVDGKQKIIFALTSIKGIGRRLANIVCKKADVD 51 >KJB65871.1 hypothetical protein B456_010G132100 [Gossypium raimondii] Length = 150 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >ONK74320.1 uncharacterized protein A4U43_C03F5030 [Asparagus officinalis] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >OMO54133.1 Ribosomal protein S13 [Corchorus capsularis] OMO98639.1 Ribosomal protein S13 [Corchorus olitorius] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >XP_019464902.1 PREDICTED: 40S ribosomal protein S18-like [Lupinus angustifolius] XP_019442064.1 PREDICTED: 40S ribosomal protein S18-like isoform X1 [Lupinus angustifolius] XP_019442065.1 PREDICTED: 40S ribosomal protein S18-like isoform X2 [Lupinus angustifolius] OIV98823.1 hypothetical protein TanjilG_25069 [Lupinus angustifolius] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANI CKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIACKKADVD 51 >XP_019427792.1 PREDICTED: 40S ribosomal protein S18-like [Lupinus angustifolius] OIV91426.1 hypothetical protein TanjilG_02044 [Lupinus angustifolius] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANI CKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIACKKADVD 51 >XP_019435035.1 PREDICTED: 40S ribosomal protein S18-like isoform X1 [Lupinus angustifolius] XP_019435036.1 PREDICTED: 40S ribosomal protein S18-like isoform X2 [Lupinus angustifolius] OIV89224.1 hypothetical protein TanjilG_24392 [Lupinus angustifolius] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANI CKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIACKKADVD 51 >XP_018846583.1 PREDICTED: 40S ribosomal protein S18 [Juglans regia] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >OAP12454.1 hypothetical protein AXX17_AT1G34840 [Arabidopsis thaliana] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >XP_015892092.1 PREDICTED: 40S ribosomal protein S18 [Ziziphus jujuba] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >NP_173692.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] NP_192718.1 S18 ribosomal protein [Arabidopsis thaliana] NP_564434.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] XP_002872461.1 hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] XP_002890533.1 hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] XP_002893800.1 hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] XP_010460045.1 PREDICTED: 40S ribosomal protein S18 [Camelina sativa] P34788.1 RecName: Full=40S ribosomal protein S18 AAG12534.1 ribosomal protein S18 [Arabidopsis thaliana] AAG12853.1 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] AAK62386.1 S18.A ribosomal protein [Arabidopsis thaliana] AAL06471.1 At1g22780/T22J18_5 [Arabidopsis thaliana] CAA80684.1 ribosomal protein S18A [Arabidopsis thaliana] CAA82273.1 S18 ribosomal protein [Arabidopsis thaliana] CAA82274.1 S18 ribosomal protein [Arabidopsis thaliana] CAA82275.1 S18 ribosomal protein [Arabidopsis thaliana] CAA72909.1 ribosomal protein S18A [Arabidopsis thaliana] AAC25506.1 Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] CAB39647.1 S18.A ribosomal protein [Arabidopsis thaliana] CAB78103.1 S18.A ribosomal protein [Arabidopsis thaliana] AAK59471.1 putative ribosomal protein S18 [Arabidopsis thaliana] AAL47500.1 putative ribosomal protein S18 [Arabidopsis thaliana] AAM63849.1 ribosomal protein S18, putative [Arabidopsis thaliana] AAM64403.1 ribosomal protein S18, putative [Arabidopsis thaliana] AAM64976.1 ribosomal protein S18, putative [Arabidopsis thaliana] AAP21347.1 At4g09800 [Arabidopsis thaliana] AAV84519.1 At1g22780 [Arabidopsis thaliana] ABF59028.1 At1g22780 [Arabidopsis thaliana] ABP96570.1 pointed first leaf [Arabidopsis thaliana] ABP96571.1 pointed first leaf [Arabidopsis thaliana] ABP96572.1 pointed first leaf [Arabidopsis thaliana] ABP96573.1 pointed first leaf [Arabidopsis thaliana] ABP96574.1 pointed first leaf [Arabidopsis thaliana] ABP96575.1 pointed first leaf [Arabidopsis thaliana] ABP96576.1 pointed first leaf [Arabidopsis thaliana] ABP96577.1 pointed first leaf [Arabidopsis thaliana] ABP96578.1 pointed first leaf [Arabidopsis thaliana] ABP96579.1 pointed first leaf [Arabidopsis thaliana] ABP96580.1 pointed first leaf [Arabidopsis thaliana] ABP96581.1 pointed first leaf [Arabidopsis thaliana] ABP96582.1 pointed first leaf [Arabidopsis thaliana] ABP96583.1 pointed first leaf [Arabidopsis thaliana] ABP96584.1 pointed first leaf [Arabidopsis thaliana] ABP96585.1 pointed first leaf [Arabidopsis thaliana] ABP96586.1 pointed first leaf [Arabidopsis thaliana] ABP96587.1 pointed first leaf [Arabidopsis thaliana] ABP96588.1 pointed first leaf [Arabidopsis thaliana] ABP96589.1 pointed first leaf [Arabidopsis thaliana] ABP96590.1 pointed first leaf [Arabidopsis thaliana] EFH48720.1 hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] EFH66792.1 hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] EFH70059.1 hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] AEE30287.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] AEE31659.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] AEE82800.1 S18 ribosomal protein [Arabidopsis thaliana] OAP00728.1 hypothetical protein AXX17_AT4G10990 [Arabidopsis thaliana] OAP14104.1 hypothetical protein AXX17_AT1G23910 [Arabidopsis thaliana] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 51 >XP_010534126.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana] XP_010538910.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >XP_010542963.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana] XP_010530129.1 PREDICTED: 40S ribosomal protein S18-like [Tarenaya hassleriana] Length = 152 Score = 100 bits (250), Expect = 5e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 171 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVD 323 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51