BLASTX nr result
ID: Phellodendron21_contig00008462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008462 (572 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006425684.1 hypothetical protein CICLE_v10027061mg [Citrus cl... 65 3e-10 KDO79534.1 hypothetical protein CISIN_1g039500mg [Citrus sinensis] 54 5e-06 >XP_006425684.1 hypothetical protein CICLE_v10027061mg [Citrus clementina] ESR38924.1 hypothetical protein CICLE_v10027061mg [Citrus clementina] Length = 149 Score = 65.5 bits (158), Expect = 3e-10 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +3 Query: 111 FYAARSHIVLDRLTIYVFIPEIMYLKLWPWSLSKVNRSYMDL*SSL-IISVSFDGD 275 ++A RS I+ D L IYV IPE YLK WPW+LSKV+RSY DL S L II VSF D Sbjct: 90 YFAPRSQILSDLLAIYVLIPENTYLKAWPWNLSKVHRSYADLLSRLIIIVVSFIND 145 >KDO79534.1 hypothetical protein CISIN_1g039500mg [Citrus sinensis] Length = 131 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +3 Query: 111 FYAARSHIVLDRLTIYVFIPEIMYLKLWPWSLSKV 215 ++A RS I+ DRL IYV IPE MYLK WPW+LSK+ Sbjct: 90 YFAPRSQILSDRLAIYVLIPENMYLKAWPWNLSKL 124