BLASTX nr result
ID: Phellodendron21_contig00008252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008252 (2177 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006434975.1 hypothetical protein CICLE_v10003672mg [Citrus cl... 77 2e-13 EEF52565.1 conserved hypothetical protein [Ricinus communis] 60 7e-07 >XP_006434975.1 hypothetical protein CICLE_v10003672mg [Citrus clementina] ESR48215.1 hypothetical protein CICLE_v10003672mg [Citrus clementina] Length = 102 Score = 77.0 bits (188), Expect = 2e-13 Identities = 52/105 (49%), Positives = 59/105 (56%), Gaps = 2/105 (1%) Frame = +1 Query: 655 MAGQKTLIKVFIFLFLGGDGTGIYYLFDYFSPALPL--AGVFCPXXXXXXXXXXXXXWSN 828 MAGQK+LIKVFIFLF GGDGTGI L + +PALPL +GVF P + Sbjct: 1 MAGQKSLIKVFIFLFSGGDGTGIILLLFFVTPALPLLVSGVFLPSFFFLVFLFFSP--TL 58 Query: 829 TKPVTIHN*DCK*FCTQLSSIQYAVKGIHKVQFIEAHQFYIHGTL 963 T V + + F S A KG KVQ IE HQFYIHGTL Sbjct: 59 TLAVLVR---YQIFNDSQSRCLRAKKGKQKVQSIETHQFYIHGTL 100 >EEF52565.1 conserved hypothetical protein [Ricinus communis] Length = 183 Score = 60.5 bits (145), Expect = 7e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +1 Query: 628 DLCHDRCACMAGQKTLIKVFIFLFLGGDGTGIYYLFDYFSPALP 759 DLCHDRCAC+AG K LIK + ++ GGDGTG++ F F PALP Sbjct: 7 DLCHDRCACLAGHKELIKFYFWVSRGGDGTGLFIPFG-FCPALP 49