BLASTX nr result
ID: Phellodendron21_contig00008121
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00008121 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO45751.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] 81 6e-15 KDO45752.1 hypothetical protein CISIN_1g020391mg [Citrus sinensi... 81 6e-15 XP_006426778.1 hypothetical protein CICLE_v10025816mg [Citrus cl... 81 9e-15 XP_006465817.1 PREDICTED: ethylene-responsive transcription fact... 81 9e-15 XP_006426779.1 hypothetical protein CICLE_v10025816mg [Citrus cl... 81 9e-15 ABK92524.1 unknown [Populus trichocarpa] 65 4e-10 AAX84670.1 ethylene response factor [Manihot esculenta] OAY53269... 68 5e-10 OMO65986.1 ethylene-responsive transcription factor RAP2-12-like... 65 8e-10 OAY36337.1 hypothetical protein MANES_11G013700 [Manihot esculen... 66 2e-09 NP_001295665.1 ethylene-responsive transcription factor RAP2-12-... 66 2e-09 CBI35806.3 unnamed protein product, partial [Vitis vinifera] 62 3e-09 XP_011036532.1 PREDICTED: ethylene-responsive transcription fact... 65 3e-09 ABK94385.1 unknown [Populus trichocarpa] 65 3e-09 XP_002304249.2 hypothetical protein POPTR_0003s06930g [Populus t... 65 3e-09 AAW33881.1 apetala2/ethylene responsive factor [Populus tremula ... 65 3e-09 XP_002533237.1 PREDICTED: ethylene-responsive transcription fact... 65 6e-09 AKL90413.1 AP2/ERF transcription factor ERF6 [Carica papaya] 65 6e-09 ADP37418.1 ethylene-responsive-element-binding factor 3 [Petunia... 64 8e-09 ADJ67434.1 ethylene response factor 5 [Actinidia deliciosa] 64 8e-09 AFY09701.1 AP2/ERF super family protein [Hevea brasiliensis] 64 8e-09 >KDO45751.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] Length = 319 Score = 81.3 bits (199), Expect = 6e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLDAFLNG+NTQD GN MNLWSFDDFPSTLGGVY Sbjct: 280 EGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 319 >KDO45752.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] KDO45753.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] KDO45754.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] Length = 326 Score = 81.3 bits (199), Expect = 6e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLDAFLNG+NTQD GN MNLWSFDDFPSTLGGVY Sbjct: 287 EGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 326 >XP_006426778.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] XP_006426782.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40018.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40022.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] Length = 386 Score = 81.3 bits (199), Expect = 9e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLDAFLNG+NTQD GN MNLWSFDDFPSTLGGVY Sbjct: 347 EGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 386 >XP_006465817.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X2 [Citrus sinensis] XP_006465818.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X1 [Citrus sinensis] XP_006465819.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X3 [Citrus sinensis] XP_015387739.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X1 [Citrus sinensis] Length = 389 Score = 81.3 bits (199), Expect = 9e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLDAFLNG+NTQD GN MNLWSFDDFPSTLGGVY Sbjct: 350 EGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 389 >XP_006426779.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] XP_006426780.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] XP_006426781.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40019.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40020.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40021.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] Length = 389 Score = 81.3 bits (199), Expect = 9e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLDAFLNG+NTQD GN MNLWSFDDFPSTLGGVY Sbjct: 350 EGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 389 >ABK92524.1 unknown [Populus trichocarpa] Length = 161 Score = 65.5 bits (158), Expect = 4e-10 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 567 GSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 G+WEASLD+FLNG+ TQD N+++LWSF+DFPS +GGVY Sbjct: 123 GNWEASLDSFLNGDTTQDGTNAVDLWSFEDFPSMVGGVY 161 >AAX84670.1 ethylene response factor [Manihot esculenta] OAY53269.1 hypothetical protein MANES_04G150100 [Manihot esculenta] OAY53270.1 hypothetical protein MANES_04G150100 [Manihot esculenta] Length = 381 Score = 67.8 bits (164), Expect = 5e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLD FLNG+ TQD GN M+LWSFDD P+ +GGVY Sbjct: 342 EGSWEASLDGFLNGDVTQDGGNPMDLWSFDDLPNMVGGVY 381 >OMO65986.1 ethylene-responsive transcription factor RAP2-12-like protein [Corchorus olitorius] Length = 165 Score = 64.7 bits (156), Expect = 8e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSW+AS+DAFLNG+ TQD N M+LWSFDDFPS GGV+ Sbjct: 126 EGSWDASIDAFLNGDATQDSVNPMDLWSFDDFPSMDGGVF 165 >OAY36337.1 hypothetical protein MANES_11G013700 [Manihot esculenta] OAY36338.1 hypothetical protein MANES_11G013700 [Manihot esculenta] OAY36339.1 hypothetical protein MANES_11G013700 [Manihot esculenta] Length = 385 Score = 66.2 bits (160), Expect = 2e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLD FLNG++TQD GN M+LWSFDD P+ +GG Y Sbjct: 346 EGSWEASLDNFLNGDSTQDGGNPMDLWSFDDLPNLVGGPY 385 >NP_001295665.1 ethylene-responsive transcription factor RAP2-12-like [Jatropha curcas] XP_012068806.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Jatropha curcas] AEJ87198.1 ethylene-responsive transcription factor [Jatropha curcas] KDP40641.1 hypothetical protein JCGZ_24640 [Jatropha curcas] Length = 385 Score = 65.9 bits (159), Expect = 2e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +GSWEASLD+FLNG+ TQD GN M+LWSFDD +GGVY Sbjct: 346 EGSWEASLDSFLNGDTTQDGGNPMDLWSFDDLAGMVGGVY 385 >CBI35806.3 unnamed protein product, partial [Vitis vinifera] Length = 108 Score = 62.0 bits (149), Expect = 3e-09 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 DG+WEAS+DA L+G+ QD GN M+LWSFDD P+ +GGV+ Sbjct: 69 DGNWEASMDALLSGDAAQDGGNPMDLWSFDDLPTVVGGVF 108 >XP_011036532.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Populus euphratica] XP_011036533.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Populus euphratica] Length = 379 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 567 GSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 G+WEASLD+FLNG+ TQD N+++LWSF+DFPS +GGVY Sbjct: 341 GNWEASLDSFLNGDTTQDGTNAVDLWSFEDFPSMVGGVY 379 >ABK94385.1 unknown [Populus trichocarpa] Length = 379 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 567 GSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 G+WEASLD+FLNG+ TQD N+++LWSF+DFPS +GGVY Sbjct: 341 GNWEASLDSFLNGDTTQDGTNAVDLWSFEDFPSMVGGVY 379 >XP_002304249.2 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] XP_006385529.1 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] XP_006385530.1 transcription factor EREBP-like family protein [Populus trichocarpa] XP_006385531.1 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] XP_006385532.1 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] EEE79228.2 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] ERP63326.1 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] ERP63327.1 transcription factor EREBP-like family protein [Populus trichocarpa] ERP63328.1 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] ERP63329.1 hypothetical protein POPTR_0003s06930g [Populus trichocarpa] Length = 380 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 567 GSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 G+WEASLD+FLNG+ TQD N+++LWSF+DFPS +GGVY Sbjct: 342 GNWEASLDSFLNGDTTQDGTNAVDLWSFEDFPSMVGGVY 380 >AAW33881.1 apetala2/ethylene responsive factor [Populus tremula x Populus alba] Length = 380 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 567 GSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 G+WEASLD+FLNG+ TQD N+++LWSF+DFPS +GGVY Sbjct: 342 GNWEASLDSFLNGDTTQDGTNAVDLWSFEDFPSMVGGVY 380 >XP_002533237.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 [Ricinus communis] XP_015583317.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 [Ricinus communis] EEF29138.1 Ethylene-responsive transcription factor, putative [Ricinus communis] Length = 383 Score = 64.7 bits (156), Expect = 6e-09 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +G+WE SL++FLNG+ TQD GN ++LWSFDD PS +GGVY Sbjct: 344 EGNWETSLESFLNGDTTQDGGNPVDLWSFDDLPSLVGGVY 383 >AKL90413.1 AP2/ERF transcription factor ERF6 [Carica papaya] Length = 395 Score = 64.7 bits (156), Expect = 6e-09 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 D +W++SLDAFLNG+ QD GNSM+LW+FDD PS +GGV+ Sbjct: 356 DSNWDSSLDAFLNGDAPQDAGNSMDLWAFDDLPSLVGGVF 395 >ADP37418.1 ethylene-responsive-element-binding factor 3 [Petunia x hybrida] Length = 363 Score = 64.3 bits (155), Expect = 8e-09 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 +G+WEAS+D LN + TQ+VGN+M+LWSFDD PS +GGVY Sbjct: 324 EGNWEASVDTLLNADATQEVGNAMDLWSFDDVPSLMGGVY 363 >ADJ67434.1 ethylene response factor 5 [Actinidia deliciosa] Length = 382 Score = 64.3 bits (155), Expect = 8e-09 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGV 454 + +W+AS+D FLNG+ TQD G+SMNLW+FDDFPS +GGV Sbjct: 344 EANWDASVDTFLNGDATQDGGSSMNLWTFDDFPSMMGGV 382 >AFY09701.1 AP2/ERF super family protein [Hevea brasiliensis] Length = 385 Score = 64.3 bits (155), Expect = 8e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 570 DGSWEASLDAFLNGNNTQDVGNSMNLWSFDDFPSTLGGVY 451 DGSW ASLD+FLNG+ TQD GN M+LWSFDD P+ GG+Y Sbjct: 346 DGSWVASLDSFLNGDATQDGGNPMDLWSFDDLPNLDGGLY 385