BLASTX nr result
ID: Phellodendron21_contig00007946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00007946 (1076 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74537.1 hypothetical protein M569_00254, partial [Genlisea au... 59 1e-07 XP_002875535.1 hypothetical protein ARALYDRAFT_905289 [Arabidops... 55 5e-06 >EPS74537.1 hypothetical protein M569_00254, partial [Genlisea aurea] Length = 89 Score = 58.9 bits (141), Expect = 1e-07 Identities = 42/86 (48%), Positives = 53/86 (61%), Gaps = 8/86 (9%) Frame = -2 Query: 562 SSLFTGSVVPIASRLMVRSEFSNGVRNEIFF--KSIFSVFIGSRLFIFLFYERIHR---- 401 S F S+VP AS LM+RSEF+NG I F +SIF VFIGS+L FL + ++R Sbjct: 1 SFAFKASIVPTASSLMIRSEFANGASILIEFNHESIFLVFIGSKLLFFL-KDSLNRSSTL 59 Query: 400 IMDALLLMLYYTVV--YEMTHRPYIL 329 + + ML Y V+ YEMT RPYIL Sbjct: 60 SVYIRVFMLCYIVLFFYEMTPRPYIL 85 >XP_002875535.1 hypothetical protein ARALYDRAFT_905289 [Arabidopsis lyrata subsp. lyrata] EFH51794.1 hypothetical protein ARALYDRAFT_905289 [Arabidopsis lyrata subsp. lyrata] Length = 112 Score = 55.1 bits (131), Expect = 5e-06 Identities = 29/38 (76%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 966 LSFARSWMRRNSHVQFCSRDGIEK-EPSIITPKEQDSV 1076 L FARSWMRRNSHVQF SRDGI EPS IT KE D V Sbjct: 69 LLFARSWMRRNSHVQFYSRDGISNLEPSTITQKEPDFV 106