BLASTX nr result
ID: Phellodendron21_contig00007779
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00007779 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015382378.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 107 2e-24 XP_006449134.1 hypothetical protein CICLE_v10017888mg [Citrus cl... 103 4e-23 KDP20817.1 hypothetical protein JCGZ_21288 [Jatropha curcas] 91 7e-19 OMO64949.1 hypothetical protein COLO4_31694 [Corchorus olitorius] 87 8e-18 GAV71266.1 Pkinase domain-containing protein/Stress-antifung dom... 88 1e-17 XP_016684325.1 PREDICTED: cysteine-rich receptor-like protein ki... 86 2e-17 KHG13311.1 Cysteine-rich receptor-like protein kinase 25 [Gossyp... 87 2e-17 KJB57698.1 hypothetical protein B456_009G176200 [Gossypium raimo... 87 2e-17 XP_017603346.1 PREDICTED: cysteine-rich receptor-like protein ki... 87 2e-17 XP_017603345.1 PREDICTED: cysteine-rich receptor-like protein ki... 87 2e-17 XP_012440629.1 PREDICTED: cysteine-rich receptor-like protein ki... 87 2e-17 XP_012440628.1 PREDICTED: cysteine-rich receptor-like protein ki... 87 2e-17 XP_012440627.1 PREDICTED: cysteine-rich receptor-like protein ki... 87 2e-17 XP_002317275.1 hypothetical protein POPTR_0011s03330g [Populus t... 86 2e-17 XP_010999623.1 PREDICTED: cysteine-rich receptor-like protein ki... 86 4e-17 OAY26048.1 hypothetical protein MANES_16G017600 [Manihot esculenta] 86 4e-17 OMO64948.1 hypothetical protein COLO4_31693 [Corchorus olitorius] 86 7e-17 OMO64947.1 hypothetical protein COLO4_31692 [Corchorus olitorius] 85 7e-17 XP_015574223.1 PREDICTED: cysteine-rich receptor-like protein ki... 85 1e-16 EEF43950.1 serine-threonine protein kinase, plant-type, putative... 85 1e-16 >XP_015382378.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC102628483 [Citrus sinensis] Length = 1377 Score = 107 bits (267), Expect = 2e-24 Identities = 57/82 (69%), Positives = 61/82 (74%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRFXXXXXXXX 208 V EALRWIHIALLCVQDDPAQRPTMS+VVLMLGS+AV+LPQPSIAPYSAGR+ Sbjct: 1296 VSEALRWIHIALLCVQDDPAQRPTMSVVVLMLGSEAVNLPQPSIAPYSAGRYTTMSDQYT 1355 Query: 207 XXXXXXXXXXXXSDQTSTSISR 142 SDQTSTSISR Sbjct: 1356 TSTSGVRTGSLASDQTSTSISR 1377 >XP_006449134.1 hypothetical protein CICLE_v10017888mg [Citrus clementina] ESR62374.1 hypothetical protein CICLE_v10017888mg [Citrus clementina] Length = 664 Score = 103 bits (256), Expect = 4e-23 Identities = 57/82 (69%), Positives = 61/82 (74%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRFXXXXXXXX 208 V EALRWIHIALLCVQDDPAQRPTMS+VVLMLGS+AV+LPQPSIAPYSAGR+ Sbjct: 584 VSEALRWIHIALLCVQDDPAQRPTMSVVVLMLGSEAVNLPQPSIAPYSAGRY-TTMSDHT 642 Query: 207 XXXXXXXXXXXXSDQTSTSISR 142 SDQTSTSISR Sbjct: 643 TSTSGVRTGSLASDQTSTSISR 664 >KDP20817.1 hypothetical protein JCGZ_21288 [Jatropha curcas] Length = 655 Score = 91.3 bits (225), Expect = 7e-19 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 V E LRWIHIALLCVQDDPA+RPTMS VVLMLGS +V+LPQPS APYS GRF Sbjct: 576 VSETLRWIHIALLCVQDDPAERPTMSSVVLMLGSNSVNLPQPSTAPYSMGRF 627 >OMO64949.1 hypothetical protein COLO4_31694 [Corchorus olitorius] Length = 337 Score = 87.0 bits (214), Expect = 8e-18 Identities = 42/52 (80%), Positives = 43/52 (82%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 V EALRWIHIALLCVQDDPA RPTMS +V ML SK VDLPQPS PYSA RF Sbjct: 259 VDEALRWIHIALLCVQDDPALRPTMSTIVFMLRSKLVDLPQPSTPPYSAARF 310 >GAV71266.1 Pkinase domain-containing protein/Stress-antifung domain-containing protein/Pkinase_Tyr domain-containing protein/RVT_2 domain-containing protein [Cephalotus follicularis] Length = 1438 Score = 87.8 bits (216), Expect = 1e-17 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -3 Query: 381 EALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 E LRWIHIALLCVQDDPA+RP MS VVLMLGS+AV+LPQPS PYS GRF Sbjct: 1361 EVLRWIHIALLCVQDDPAERPNMSSVVLMLGSQAVNLPQPSTPPYSVGRF 1410 >XP_016684325.1 PREDICTED: cysteine-rich receptor-like protein kinase 10 [Gossypium hirsutum] Length = 322 Score = 85.9 bits (211), Expect = 2e-17 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PY+A RF Sbjct: 255 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYAAARF 306 >KHG13311.1 Cysteine-rich receptor-like protein kinase 25 [Gossypium arboreum] Length = 603 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 536 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 587 >KJB57698.1 hypothetical protein B456_009G176200 [Gossypium raimondii] Length = 638 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 571 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 622 >XP_017603346.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X2 [Gossypium arboreum] Length = 656 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 589 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 640 >XP_017603345.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X1 [Gossypium arboreum] Length = 657 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 590 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 641 >XP_012440629.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X3 [Gossypium raimondii] Length = 659 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 592 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 643 >XP_012440628.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X2 [Gossypium raimondii] Length = 660 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 593 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 644 >XP_012440627.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X1 [Gossypium raimondii] Length = 661 Score = 87.0 bits (214), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + E LRWIHIALLCVQDDPA RPTMS +LMLGSK+V+LPQPS +PYSA RF Sbjct: 594 IQEVLRWIHIALLCVQDDPALRPTMSSAILMLGSKSVNLPQPSTSPYSAARF 645 >XP_002317275.1 hypothetical protein POPTR_0011s03330g [Populus trichocarpa] EEE97887.1 hypothetical protein POPTR_0011s03330g [Populus trichocarpa] Length = 402 Score = 86.3 bits (212), Expect = 2e-17 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 V EALRWIHIALLCVQDDPA+RPTMSLVVLMLGS AV+LPQPS P S +F Sbjct: 322 VSEALRWIHIALLCVQDDPARRPTMSLVVLMLGSNAVNLPQPSTGPKSLVKF 373 >XP_010999623.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Populus euphratica] Length = 676 Score = 86.3 bits (212), Expect = 4e-17 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 V EALRWIHIALLCVQDDPA+RPTMSLVVLMLGS AV+LPQPS P S +F Sbjct: 596 VSEALRWIHIALLCVQDDPARRPTMSLVVLMLGSNAVNLPQPSTGPKSPVKF 647 >OAY26048.1 hypothetical protein MANES_16G017600 [Manihot esculenta] Length = 438 Score = 85.9 bits (211), Expect = 4e-17 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -3 Query: 381 EALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 EALRWIHIALLCVQDDPA+RPTMS VVLMLGSK+ +LP PS APYS RF Sbjct: 361 EALRWIHIALLCVQDDPAERPTMSSVVLMLGSKSANLPPPSTAPYSMVRF 410 >OMO64948.1 hypothetical protein COLO4_31693 [Corchorus olitorius] Length = 597 Score = 85.5 bits (210), Expect = 7e-17 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + EA+RWIHIALLCVQDDPA RPTMS +LML SK+VDLPQPS PYSA RF Sbjct: 516 IDEAVRWIHIALLCVQDDPALRPTMSTAILMLRSKSVDLPQPSTPPYSATRF 567 >OMO64947.1 hypothetical protein COLO4_31692 [Corchorus olitorius] Length = 424 Score = 85.1 bits (209), Expect = 7e-17 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = -3 Query: 387 VGEALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 + + LRWIHIALLCVQDDPA RP MS VVLMLGSK+V+LPQPS PYSA RF Sbjct: 344 IQDVLRWIHIALLCVQDDPALRPPMSAVVLMLGSKSVNLPQPSTPPYSAARF 395 >XP_015574223.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Ricinus communis] Length = 671 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 381 EALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 E LRWI IALLCVQDDPA+RPTMS VVLMLGSK++ LPQPS APY+ GRF Sbjct: 597 EVLRWIQIALLCVQDDPAERPTMSSVVLMLGSKSMILPQPSTAPYTMGRF 646 >EEF43950.1 serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 1390 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 381 EALRWIHIALLCVQDDPAQRPTMSLVVLMLGSKAVDLPQPSIAPYSAGRF 232 E LRWI IALLCVQDDPA+RPTMS VVLMLGSK++ LPQPS APY+ GRF Sbjct: 1316 EVLRWIQIALLCVQDDPAERPTMSSVVLMLGSKSMILPQPSTAPYTMGRF 1365