BLASTX nr result
ID: Phellodendron21_contig00007762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00007762 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006425739.1 hypothetical protein CICLE_v10025839mg [Citrus cl... 59 4e-08 XP_010254953.1 PREDICTED: UPF0496 protein At4g34320-like [Nelumb... 57 3e-07 XP_002525093.1 PREDICTED: UPF0496 protein At2g18630 [Ricinus com... 55 9e-07 XP_002525095.1 PREDICTED: UPF0496 protein At2g18630 [Ricinus com... 53 6e-06 XP_012837014.1 PREDICTED: UPF0496 protein At4g34320-like [Erythr... 53 8e-06 >XP_006425739.1 hypothetical protein CICLE_v10025839mg [Citrus clementina] XP_006425740.1 hypothetical protein CICLE_v10025839mg [Citrus clementina] XP_006466717.1 PREDICTED: UPF0496 protein At2g18630 [Citrus sinensis] XP_006466718.1 PREDICTED: UPF0496 protein At2g18630 [Citrus sinensis] ESR38979.1 hypothetical protein CICLE_v10025839mg [Citrus clementina] ESR38980.1 hypothetical protein CICLE_v10025839mg [Citrus clementina] KDO79464.1 hypothetical protein CISIN_1g016839mg [Citrus sinensis] KDO79465.1 hypothetical protein CISIN_1g016839mg [Citrus sinensis] Length = 381 Score = 59.3 bits (142), Expect = 4e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 EDLCEHADKCSHDIRKARTVILQRIIKYPNN 93 E LC+HADKCS DIR+ARTVILQ+IIKYPNN Sbjct: 351 EVLCDHADKCSRDIRRARTVILQKIIKYPNN 381 >XP_010254953.1 PREDICTED: UPF0496 protein At4g34320-like [Nelumbo nucifera] Length = 375 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 EDLCEHADKCSHDIRKARTVILQRIIKYPNN 93 EDL EHAD+CS DIR+ARTV+LQRIIK+PNN Sbjct: 345 EDLGEHADRCSRDIRRARTVVLQRIIKHPNN 375 >XP_002525093.1 PREDICTED: UPF0496 protein At2g18630 [Ricinus communis] EEF37220.1 AT14A, putative [Ricinus communis] Length = 348 Score = 55.5 bits (132), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 EDLCEHADKCSHDIRKARTVILQRIIKYPN 90 EDL EHA KCSHDIR+ARTVILQRII+YP+ Sbjct: 318 EDLGEHASKCSHDIRQARTVILQRIIRYPD 347 >XP_002525095.1 PREDICTED: UPF0496 protein At2g18630 [Ricinus communis] EEF37222.1 AT14A, putative [Ricinus communis] Length = 390 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 EDLCEHADKCSHDIRKARTVILQRIIKYPN 90 EDL EHA KCSHDI +ARTVILQRII+YP+ Sbjct: 360 EDLGEHASKCSHDITQARTVILQRIIRYPD 389 >XP_012837014.1 PREDICTED: UPF0496 protein At4g34320-like [Erythranthe guttata] EYU37760.1 hypothetical protein MIMGU_mgv1a008357mg [Erythranthe guttata] Length = 376 Score = 52.8 bits (125), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 EDLCEHADKCSHDIRKARTVILQRIIKYPNN 93 E+L + ADKCS DIR+ARTVILQRIIK+PNN Sbjct: 345 EELGDQADKCSRDIRRARTVILQRIIKHPNN 375