BLASTX nr result
ID: Phellodendron21_contig00007742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00007742 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005649925.1 hypothetical protein COCSUDRAFT_61600 [Coccomyxa ... 55 3e-06 XP_005851999.1 hypothetical protein CHLNCDRAFT_13796, partial [C... 52 9e-06 >XP_005649925.1 hypothetical protein COCSUDRAFT_61600 [Coccomyxa subellipsoidea C-169] EIE25381.1 hypothetical protein COCSUDRAFT_61600 [Coccomyxa subellipsoidea C-169] Length = 1006 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/61 (42%), Positives = 38/61 (62%) Frame = -2 Query: 420 PWPTVAVFFLFTIATAVPVLKGVPRKGNGFFSSDAEIVNGRLAMVGFAFIVFSTALKGTF 241 P V L T+A+A+P KGV R GN F+ DAE+ NGRLAM+G ++ +T +G+ Sbjct: 946 PLLIVTTVVLITVASAIPFYKGVRRSGNSVFTPDAELWNGRLAMLGIVAVIINTWNRGSI 1005 Query: 240 W 238 + Sbjct: 1006 F 1006 >XP_005851999.1 hypothetical protein CHLNCDRAFT_13796, partial [Chlorella variabilis] EFN59897.1 hypothetical protein CHLNCDRAFT_13796, partial [Chlorella variabilis] Length = 113 Score = 51.6 bits (122), Expect = 9e-06 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -2 Query: 414 PTVAVFFLFTIATAVPVLKGVPRKGN-GFFSSDAEIVNGRLAMVGFAFIVFSTALKGT 244 P A F LF +A+ +P+ KGV + + G F+ +AE+ NGR AM+GFA ++ A+KG+ Sbjct: 53 PIAATFALFAVASLIPIFKGVKNEESFGPFTPNAELSNGRWAMIGFASLLIVEAVKGS 110