BLASTX nr result
ID: Phellodendron21_contig00007015
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00007015 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006436353.1 hypothetical protein CICLE_v100316311mg, partial ... 81 6e-18 AAL14611.1 putative delta-7-sterol reductase, partial [Castanea ... 79 3e-17 AQK70865.1 7-dehydrocholesterol reductase [Zea mays] 80 8e-17 AQK70862.1 7-dehydrocholesterol reductase [Zea mays] 80 9e-17 OMO65493.1 Ergosterol biosynthesis ERG4/ERG24 [Corchorus olitorius] 79 5e-16 AFK37028.1 unknown [Lotus japonicus] 79 6e-16 AQK70857.1 7-dehydrocholesterol reductase [Zea mays] 80 9e-16 XP_010927281.2 PREDICTED: 7-dehydrocholesterol reductase isoform... 79 1e-15 XP_019707185.1 PREDICTED: 7-dehydrocholesterol reductase isoform... 79 1e-15 XP_006393153.1 hypothetical protein EUTSA_v10011498mg [Eutrema s... 81 1e-15 XP_015571229.1 PREDICTED: 7-dehydrocholesterol reductase [Ricinu... 81 1e-15 XP_006465140.1 PREDICTED: 7-dehydrocholesterol reductase [Citrus... 81 1e-15 ABK93973.1 unknown [Populus trichocarpa] 80 2e-15 XP_018488639.1 PREDICTED: 7-dehydrocholesterol reductase-like [R... 80 2e-15 XP_018477406.1 PREDICTED: 7-dehydrocholesterol reductase [Raphan... 80 2e-15 XP_010479502.1 PREDICTED: 7-dehydrocholesterol reductase [Cameli... 80 2e-15 XP_010461896.1 PREDICTED: 7-dehydrocholesterol reductase [Cameli... 80 2e-15 XP_010500610.1 PREDICTED: 7-dehydrocholesterol reductase-like [C... 80 2e-15 XP_013622239.1 PREDICTED: 7-dehydrocholesterol reductase [Brassi... 80 2e-15 XP_009107218.1 PREDICTED: 7-dehydrocholesterol reductase [Brassi... 80 2e-15 >XP_006436353.1 hypothetical protein CICLE_v100316311mg, partial [Citrus clementina] ESR49593.1 hypothetical protein CICLE_v100316311mg, partial [Citrus clementina] Length = 76 Score = 80.9 bits (198), Expect = 6e-18 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWKIYC+KV YRIIPGIY Sbjct: 39 ILLFDRAKRDDDRCRSKYGKYWKIYCQKVPYRIIPGIY 76 >AAL14611.1 putative delta-7-sterol reductase, partial [Castanea sativa] Length = 67 Score = 79.0 bits (193), Expect = 3e-17 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK++C+KV YRIIPGIY Sbjct: 30 ILLFDRAKRDDDRCRSKYGKYWKVFCEKVPYRIIPGIY 67 >AQK70865.1 7-dehydrocholesterol reductase [Zea mays] Length = 131 Score = 79.7 bits (195), Expect = 8e-17 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC SKYGKYWKIYC KV YR+IPGIY Sbjct: 94 ILLFDRAKRDDDRCSSKYGKYWKIYCNKVPYRVIPGIY 131 >AQK70862.1 7-dehydrocholesterol reductase [Zea mays] Length = 138 Score = 79.7 bits (195), Expect = 9e-17 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC SKYGKYWKIYC KV YR+IPGIY Sbjct: 101 ILLFDRAKRDDDRCSSKYGKYWKIYCNKVPYRVIPGIY 138 >OMO65493.1 Ergosterol biosynthesis ERG4/ERG24 [Corchorus olitorius] Length = 181 Score = 79.0 bits (193), Expect = 5e-16 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC KV YR+IPGIY Sbjct: 144 ILLFDRAKRDDDRCRSKYGKYWKLYCTKVPYRVIPGIY 181 >AFK37028.1 unknown [Lotus japonicus] Length = 206 Score = 79.3 bits (194), Expect = 6e-16 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC KV YRIIPGIY Sbjct: 169 ILLFDRAKRDDDRCRSKYGKYWKLYCDKVPYRIIPGIY 206 >AQK70857.1 7-dehydrocholesterol reductase [Zea mays] Length = 253 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC SKYGKYWKIYC KV YR+IPGIY Sbjct: 216 ILLFDRAKRDDDRCSSKYGKYWKIYCNKVPYRVIPGIY 253 >XP_010927281.2 PREDICTED: 7-dehydrocholesterol reductase isoform X2 [Elaeis guineensis] Length = 253 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC SKYGKYWK+YC+KV YRIIPGIY Sbjct: 216 ILLFDRAKRDDDRCSSKYGKYWKMYCEKVPYRIIPGIY 253 >XP_019707185.1 PREDICTED: 7-dehydrocholesterol reductase isoform X1 [Elaeis guineensis] Length = 256 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC SKYGKYWK+YC+KV YRIIPGIY Sbjct: 219 ILLFDRAKRDDDRCSSKYGKYWKMYCEKVPYRIIPGIY 256 >XP_006393153.1 hypothetical protein EUTSA_v10011498mg [Eutrema salsugineum] ESQ30439.1 hypothetical protein EUTSA_v10011498mg [Eutrema salsugineum] Length = 432 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIIPGIY 432 >XP_015571229.1 PREDICTED: 7-dehydrocholesterol reductase [Ricinus communis] Length = 434 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 397 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIIPGIY 434 >XP_006465140.1 PREDICTED: 7-dehydrocholesterol reductase [Citrus sinensis] Length = 437 Score = 80.9 bits (198), Expect = 1e-15 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWKIYC+KV YRIIPGIY Sbjct: 400 ILLFDRAKRDDDRCRSKYGKYWKIYCQKVPYRIIPGIY 437 >ABK93973.1 unknown [Populus trichocarpa] Length = 400 Score = 80.5 bits (197), Expect = 2e-15 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRI+PGIY Sbjct: 363 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIVPGIY 400 >XP_018488639.1 PREDICTED: 7-dehydrocholesterol reductase-like [Raphanus sativus] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRI+PGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIVPGIY 432 >XP_018477406.1 PREDICTED: 7-dehydrocholesterol reductase [Raphanus sativus] XP_018477419.1 PREDICTED: 7-dehydrocholesterol reductase [Raphanus sativus] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >XP_010479502.1 PREDICTED: 7-dehydrocholesterol reductase [Camelina sativa] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >XP_010461896.1 PREDICTED: 7-dehydrocholesterol reductase [Camelina sativa] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >XP_010500610.1 PREDICTED: 7-dehydrocholesterol reductase-like [Camelina sativa] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >XP_013622239.1 PREDICTED: 7-dehydrocholesterol reductase [Brassica oleracea var. oleracea] XP_013714731.1 PREDICTED: 7-dehydrocholesterol reductase [Brassica napus] CDY03603.1 BnaC03g68620D [Brassica napus] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >XP_009107218.1 PREDICTED: 7-dehydrocholesterol reductase [Brassica rapa] XP_013735823.1 PREDICTED: 7-dehydrocholesterol reductase-like [Brassica napus] CDY45061.1 BnaA08g02140D [Brassica napus] Length = 432 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 344 ILLFDRAKRDDDRCQSKYGKYWKIYCKKVHYRIIPGIY 231 ILLFDRAKRDDDRC+SKYGKYWK+YC+KV YRIIPGIY Sbjct: 395 ILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432