BLASTX nr result
ID: Phellodendron21_contig00006717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00006717 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006490015.1 PREDICTED: ethylene-responsive transcription fact... 68 5e-11 XP_006421525.1 hypothetical protein CICLE_v10005750mg [Citrus cl... 68 5e-11 XP_006421524.1 hypothetical protein CICLE_v10005570mg [Citrus cl... 57 1e-06 XP_006490016.2 PREDICTED: ethylene-responsive transcription fact... 55 3e-06 XP_016491248.1 PREDICTED: ethylene-responsive transcription fact... 55 4e-06 XP_009804351.1 PREDICTED: ethylene-responsive transcription fact... 55 4e-06 GAV79482.1 AP2 domain-containing protein [Cephalotus follicularis] 55 5e-06 >XP_006490015.1 PREDICTED: ethylene-responsive transcription factor ERF105 [Citrus sinensis] KDO38348.1 hypothetical protein CISIN_1g026385mg [Citrus sinensis] Length = 239 Score = 68.2 bits (165), Expect = 5e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 396 GPLTPSSWTGIWDDGKGIFTVPPLSPYSCFGQLGV 292 GPLTPSSWTG WDDG GIF+VPPLSP CFGQLGV Sbjct: 206 GPLTPSSWTGFWDDGNGIFSVPPLSP--CFGQLGV 238 >XP_006421525.1 hypothetical protein CICLE_v10005750mg [Citrus clementina] ESR34765.1 hypothetical protein CICLE_v10005750mg [Citrus clementina] Length = 239 Score = 68.2 bits (165), Expect = 5e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 396 GPLTPSSWTGIWDDGKGIFTVPPLSPYSCFGQLGV 292 GPLTPSSWTG WDDG GIF+VPPLSP CFGQLGV Sbjct: 206 GPLTPSSWTGFWDDGNGIFSVPPLSP--CFGQLGV 238 >XP_006421524.1 hypothetical protein CICLE_v10005570mg [Citrus clementina] ESR34764.1 hypothetical protein CICLE_v10005570mg [Citrus clementina] Length = 285 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 396 GPLTPSSWTGIWDDGKGIFTVPPLSPYS 313 GPLTPSSWTG WD KGIFTVPPLSP S Sbjct: 247 GPLTPSSWTGFWDGEKGIFTVPPLSPLS 274 >XP_006490016.2 PREDICTED: ethylene-responsive transcription factor ERF104-like [Citrus sinensis] KDO40615.1 hypothetical protein CISIN_1g023209mg [Citrus sinensis] Length = 285 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -1 Query: 396 GPLTPSSWTGIWDDGKGIFTVPPLSPYS 313 GPLTPS+WTG WD KGIFTVPPLSP S Sbjct: 247 GPLTPSNWTGFWDGEKGIFTVPPLSPLS 274 >XP_016491248.1 PREDICTED: ethylene-responsive transcription factor 5 [Nicotiana tabacum] Q9LW48.1 RecName: Full=Ethylene-responsive transcription factor 5; AltName: Full=Ethylene-responsive element-binding factor 4; Short=EREBP-4; AltName: Full=Ethylene-responsive element-binding factor 5 homolog; AltName: Full=NsERF4 BAA97124.1 ethylene-responsive element binding factor [Nicotiana sylvestris] Length = 282 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/34 (70%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = -1 Query: 393 PLTPSSWTGIWD--DGKGIFTVPPLSPYSCFGQL 298 PLTPSSW+ IWD DGKGIF VPPLSP+ + QL Sbjct: 246 PLTPSSWSAIWDSGDGKGIFEVPPLSPFGAYSQL 279 >XP_009804351.1 PREDICTED: ethylene-responsive transcription factor 5 [Nicotiana sylvestris] Length = 282 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/34 (70%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = -1 Query: 393 PLTPSSWTGIWD--DGKGIFTVPPLSPYSCFGQL 298 PLTPSSW+ IWD DGKGIF VPPLSP+ + QL Sbjct: 246 PLTPSSWSAIWDSGDGKGIFEVPPLSPFGAYSQL 279 >GAV79482.1 AP2 domain-containing protein [Cephalotus follicularis] Length = 291 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 393 PLTPSSWTGIWDDGKGIFTVPPLSPYSCFGQLG 295 PLTPS+WT +WDD KGIF+VPPLSP S +G Sbjct: 252 PLTPSNWTAVWDDAKGIFSVPPLSPLSPHPSMG 284