BLASTX nr result
ID: Phellodendron21_contig00006714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00006714 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408805.1 secreted protein [Melampsora larici-populina 98AG... 51 1e-05 >XP_007408805.1 secreted protein [Melampsora larici-populina 98AG31] EGG08040.1 secreted protein [Melampsora larici-populina 98AG31] Length = 110 Score = 51.2 bits (121), Expect = 1e-05 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -1 Query: 161 TPDSLAPRYIIVGQPPPNCTKGHVCPLAKPVGTPIETR 48 T D++ PRYII GQPPP C K H+CPLAK +PI R Sbjct: 27 THDTIEPRYIIEGQPPPPC-KNHICPLAKSTDSPIVAR 63