BLASTX nr result
ID: Phellodendron21_contig00006650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00006650 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO44123.1 hypothetical protein CISIN_1g0179201mg, partial [Citr... 64 3e-11 XP_018845763.1 PREDICTED: diaminopimelate epimerase, chloroplast... 65 8e-11 CBI32677.3 unnamed protein product, partial [Vitis vinifera] 66 2e-10 XP_002278566.1 PREDICTED: diaminopimelate epimerase, chloroplast... 66 2e-10 XP_007027115.2 PREDICTED: diaminopimelate epimerase, chloroplast... 65 5e-10 XP_017237698.1 PREDICTED: diaminopimelate epimerase, chloroplast... 65 5e-10 KNA11730.1 hypothetical protein SOVF_132440 [Spinacia oleracea] 65 5e-10 XP_010670422.1 PREDICTED: diaminopimelate epimerase, chloroplast... 65 7e-10 XP_012831970.1 PREDICTED: diaminopimelate epimerase, chloroplast... 65 7e-10 KZV35058.1 diaminopimelate epimerase, chloroplastic [Dorcoceras ... 65 7e-10 XP_011094810.1 PREDICTED: diaminopimelate epimerase, chloroplast... 64 9e-10 ONK61918.1 uncharacterized protein A4U43_C08F34910 [Asparagus of... 64 1e-09 XP_008241580.1 PREDICTED: diaminopimelate epimerase, chloroplast... 64 1e-09 XP_007205407.1 hypothetical protein PRUPE_ppa007581mg [Prunus pe... 64 1e-09 XP_010922398.1 PREDICTED: diaminopimelate epimerase, chloroplast... 64 2e-09 OMO97124.1 Diaminopimelate epimerase, DapF [Corchorus olitorius] 64 2e-09 OMO72730.1 Diaminopimelate epimerase, DapF [Corchorus capsularis] 64 2e-09 XP_016455889.1 PREDICTED: diaminopimelate epimerase, chloroplast... 62 2e-09 XP_006480734.1 PREDICTED: diaminopimelate epimerase, chloroplast... 63 2e-09 XP_006429008.1 hypothetical protein CICLE_v10012025mg [Citrus cl... 63 2e-09 >KDO44123.1 hypothetical protein CISIN_1g0179201mg, partial [Citrus sinensis] Length = 83 Score = 63.9 bits (154), Expect = 3e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPLN 254 PLDIEW+EEDNHVYMTGPAEVVFYGSV LN Sbjct: 54 PLDIEWKEEDNHVYMTGPAEVVFYGSVLLN 83 >XP_018845763.1 PREDICTED: diaminopimelate epimerase, chloroplastic-like [Juglans regia] Length = 167 Score = 65.1 bits (157), Expect = 8e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNHVYMTGPAEVVFYGSVPL Sbjct: 139 PLEIEWREEDNHVYMTGPAEVVFYGSVPL 167 >CBI32677.3 unnamed protein product, partial [Vitis vinifera] Length = 307 Score = 66.2 bits (160), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PLDIEWREEDNHVYMTGPAE+VFYGSVPL Sbjct: 279 PLDIEWREEDNHVYMTGPAEIVFYGSVPL 307 >XP_002278566.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Vitis vinifera] Length = 370 Score = 66.2 bits (160), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PLDIEWREEDNHVYMTGPAE+VFYGSVPL Sbjct: 342 PLDIEWREEDNHVYMTGPAEIVFYGSVPL 370 >XP_007027115.2 PREDICTED: diaminopimelate epimerase, chloroplastic [Theobroma cacao] Length = 361 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNHVYMTGPAEVVFYGSVPL Sbjct: 333 PLEIEWREEDNHVYMTGPAEVVFYGSVPL 361 >XP_017237698.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Daucus carota subsp. sativus] KZN00504.1 hypothetical protein DCAR_009258 [Daucus carota subsp. sativus] Length = 366 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNHVYMTGPAEVVFYGSVPL Sbjct: 338 PLEIEWREEDNHVYMTGPAEVVFYGSVPL 366 >KNA11730.1 hypothetical protein SOVF_132440 [Spinacia oleracea] Length = 366 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNHVYMTGPAEVVFYGSVPL Sbjct: 338 PLEIEWREEDNHVYMTGPAEVVFYGSVPL 366 >XP_010670422.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Beta vulgaris subsp. vulgaris] KMT17057.1 hypothetical protein BVRB_2g041180 [Beta vulgaris subsp. vulgaris] Length = 365 Score = 64.7 bits (156), Expect = 7e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNH+YMTGPAEVVFYGSVPL Sbjct: 337 PLEIEWREEDNHIYMTGPAEVVFYGSVPL 365 >XP_012831970.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Erythranthe guttata] EYU41679.1 hypothetical protein MIMGU_mgv1a008693mg [Erythranthe guttata] Length = 365 Score = 64.7 bits (156), Expect = 7e-10 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PLDIEWREEDNH+YMTGPA++VFYGSVPL Sbjct: 337 PLDIEWREEDNHIYMTGPAQIVFYGSVPL 365 >KZV35058.1 diaminopimelate epimerase, chloroplastic [Dorcoceras hygrometricum] Length = 368 Score = 64.7 bits (156), Expect = 7e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PLDIEWREEDNH+YMTGPAEVVFYGS PL Sbjct: 340 PLDIEWREEDNHIYMTGPAEVVFYGSAPL 368 >XP_011094810.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Sesamum indicum] Length = 366 Score = 64.3 bits (155), Expect = 9e-10 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PLDIEWRE DNHVYMTGPAEVVFYGSVPL Sbjct: 338 PLDIEWREADNHVYMTGPAEVVFYGSVPL 366 >ONK61918.1 uncharacterized protein A4U43_C08F34910 [Asparagus officinalis] Length = 311 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNHVYMTGPAEVVFYGS+PL Sbjct: 283 PLEIEWREEDNHVYMTGPAEVVFYGSLPL 311 >XP_008241580.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Prunus mume] Length = 363 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL IEWREEDNH+YMTGPAEVVFYGSVPL Sbjct: 335 PLQIEWREEDNHIYMTGPAEVVFYGSVPL 363 >XP_007205407.1 hypothetical protein PRUPE_ppa007581mg [Prunus persica] ONI03290.1 hypothetical protein PRUPE_6G249100 [Prunus persica] Length = 363 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL IEWREEDNH+YMTGPAEVVFYGSVPL Sbjct: 335 PLQIEWREEDNHIYMTGPAEVVFYGSVPL 363 >XP_010922398.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Elaeis guineensis] Length = 356 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWREEDNHVYMTGPAE VFYGSVPL Sbjct: 328 PLEIEWREEDNHVYMTGPAEAVFYGSVPL 356 >OMO97124.1 Diaminopimelate epimerase, DapF [Corchorus olitorius] Length = 361 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWRE+DNH+YMTGPAEVVFYGSVPL Sbjct: 333 PLEIEWREDDNHIYMTGPAEVVFYGSVPL 361 >OMO72730.1 Diaminopimelate epimerase, DapF [Corchorus capsularis] Length = 361 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PL+IEWRE+DNH+YMTGPAEVVFYGSVPL Sbjct: 333 PLEIEWREDDNHIYMTGPAEVVFYGSVPL 361 >XP_016455889.1 PREDICTED: diaminopimelate epimerase, chloroplastic-like [Nicotiana tabacum] XP_016455951.1 PREDICTED: diaminopimelate epimerase, chloroplastic-like [Nicotiana tabacum] Length = 214 Score = 62.4 bits (150), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPL 257 PLDIEW E+DNH+YMTGPAEVVFYGSVPL Sbjct: 186 PLDIEWSEKDNHIYMTGPAEVVFYGSVPL 214 >XP_006480734.1 PREDICTED: diaminopimelate epimerase, chloroplastic [Citrus sinensis] Length = 364 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPLN 254 PLDIEW EEDNHVYMTGPAEVVFYGSV LN Sbjct: 335 PLDIEWEEEDNHVYMTGPAEVVFYGSVLLN 364 >XP_006429008.1 hypothetical protein CICLE_v10012025mg [Citrus clementina] ESR42248.1 hypothetical protein CICLE_v10012025mg [Citrus clementina] Length = 364 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 343 PLDIEWREEDNHVYMTGPAEVVFYGSVPLN 254 PLDIEW EEDNHVYMTGPAEVVFYGSV LN Sbjct: 335 PLDIEWEEEDNHVYMTGPAEVVFYGSVLLN 364