BLASTX nr result
ID: Phellodendron21_contig00006557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00006557 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO48066.1 hypothetical protein CISIN_1g014245mg [Citrus sinensis] 56 2e-06 KDO48065.1 hypothetical protein CISIN_1g014245mg [Citrus sinensis] 56 2e-06 >KDO48066.1 hypothetical protein CISIN_1g014245mg [Citrus sinensis] Length = 426 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 2 SMETPEXXXXXXXXRIIESKTRESGAFFWKWRPKLVRTC 118 S ETP+ RIIESKTRESG FWKWR KL+RTC Sbjct: 388 SRETPDHTKTKHKRRIIESKTRESGTLFWKWRQKLIRTC 426 >KDO48065.1 hypothetical protein CISIN_1g014245mg [Citrus sinensis] Length = 428 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 2 SMETPEXXXXXXXXRIIESKTRESGAFFWKWRPKLVRTC 118 S ETP+ RIIESKTRESG FWKWR KL+RTC Sbjct: 390 SRETPDHTKTKHKRRIIESKTRESGTLFWKWRQKLIRTC 428