BLASTX nr result
ID: Phellodendron21_contig00006441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00006441 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006429782.1 hypothetical protein CICLE_v10011544mg [Citrus cl... 54 8e-06 >XP_006429782.1 hypothetical protein CICLE_v10011544mg [Citrus clementina] ESR43022.1 hypothetical protein CICLE_v10011544mg [Citrus clementina] Length = 499 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 390 EPDGEMRMRVKEMSEKGRKALMDGGSSFSAVGR 292 E + EMRMRVKEMSEK RKAL DGGSSFS++GR Sbjct: 457 EHNSEMRMRVKEMSEKARKALSDGGSSFSSMGR 489