BLASTX nr result
ID: Phellodendron21_contig00006393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00006393 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403801.1 hypothetical protein MELLADRAFT_87175 [Melampsora... 66 6e-10 KNF02113.1 hypothetical protein PSTG_04612 [Puccinia striiformis... 60 4e-08 OAV96160.1 hypothetical protein PTTG_03403 [Puccinia triticina 1... 57 7e-07 KNZ43667.1 hypothetical protein VP01_99g6 [Puccinia sorghi] 57 1e-06 XP_003335618.2 hypothetical protein PGTG_16390 [Puccinia gramini... 57 1e-06 >XP_007403801.1 hypothetical protein MELLADRAFT_87175 [Melampsora larici-populina 98AG31] EGG12863.1 hypothetical protein MELLADRAFT_87175 [Melampsora larici-populina 98AG31] Length = 408 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/47 (61%), Positives = 39/47 (82%) Frame = +3 Query: 267 LRPYLALARTQAPIGSVLLFLPCASSIALACSAVSAPPSVLAYQTGI 407 ++PYLA++R Q+PIGS+LLFLPCA+SI LA +++ PPS L YQ GI Sbjct: 99 IKPYLAISRIQSPIGSILLFLPCATSITLASTSILLPPSQLIYQLGI 145 >KNF02113.1 hypothetical protein PSTG_04612 [Puccinia striiformis f. sp. tritici PST-78] Length = 384 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +3 Query: 267 LRPYLALARTQAPIGSVLLFLPCASSIALACSAVSAPPSVLAYQT 401 + PYLAL+R +APIG+ LLFLPC SS+ALA S+ +A P L YQT Sbjct: 93 IEPYLALSRVRAPIGAALLFLPCGSSLALAASSGAASPQFLIYQT 137 >OAV96160.1 hypothetical protein PTTG_03403 [Puccinia triticina 1-1 BBBD Race 1] Length = 381 Score = 57.0 bits (136), Expect = 7e-07 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +3 Query: 267 LRPYLALARTQAPIGSVLLFLPCASSIALACSAVSAPPSVLAYQTGI 407 + PYLAL+R +APIG+VLLFLPC SS+ALA S+ + P L Q+ I Sbjct: 90 IEPYLALSRVRAPIGAVLLFLPCGSSLALAASSAAVSPQFLIAQSCI 136 >KNZ43667.1 hypothetical protein VP01_99g6 [Puccinia sorghi] Length = 410 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +3 Query: 252 RYLDLLRPYLALARTQAPIGSVLLFLPCASSIALACSAVSAPPSVLAYQT 401 + ++ ++PYL L+R +APIG+VLLFLPC SS+ALA S+ + P L QT Sbjct: 124 KLIERIQPYLELSRVRAPIGTVLLFLPCGSSLALAASSGAVTPQFLISQT 173 >XP_003335618.2 hypothetical protein PGTG_16390 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP91199.2 hypothetical protein PGTG_16390 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 419 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 267 LRPYLALARTQAPIGSVLLFLPCASSIALACSAVSAPPSVLAYQT 401 + PYLAL+R +APIG+ LLFLPC SS+ALA S+ + P L QT Sbjct: 128 IEPYLALSRVRAPIGAALLFLPCGSSLALAASSAAVSPQFLIAQT 172