BLASTX nr result

ID: Phellodendron21_contig00006084 seq

BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Phellodendron21_contig00006084
         (349 letters)

Database: ./nr 
           115,041,592 sequences; 42,171,959,267 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

XP_019579115.1 PREDICTED: histone H4-like, partial [Rhinolophus ...   182   8e-58
JAU24228.1 hypothetical protein GA_TR3665_c2_g1_i1_g.12549, part...   182   8e-58
XP_019579135.1 PREDICTED: histone H4-like, partial [Rhinolophus ...   182   9e-58
EYU41919.1 hypothetical protein MIMGU_mgv1a024124mg, partial [Er...   182   9e-58
XP_002862282.1 hypothetical protein ARALYDRAFT_497532 [Arabidops...   182   9e-58
OAY83940.1 Histone H4 [Ananas comosus]                                182   9e-58
prf||1101277A histone H4 [Triticum aestivum]                          182   9e-58
BAB71814.1 histone H4, partial [Citrus jambhiri]                      182   9e-58
XP_020176745.1 histone H4-like [Aegilops tauschii subsp. tauschii]    182   1e-57
XP_011087009.1 PREDICTED: histone H4-like, partial [Sesamum indi...   182   1e-57
XP_010913656.1 PREDICTED: histone H4-like [Elaeis guineensis]         182   1e-57
ACG31455.1 histone H4 [Zea mays]                                      182   1e-57
ACG31227.1 histone H4 [Zea mays]                                      182   1e-57
ACG31208.1 histone H4 [Zea mays]                                      182   1e-57
ACG30729.1 histone H4 [Zea mays]                                      182   1e-57
P62786.2 RecName: Full=Histone H4 variant TH091 AAA34292.1 histo...   182   1e-57
WP_072354057.1 hypothetical protein [Klebsiella pneumoniae] NP_1...   182   1e-57
XP_008371481.1 PREDICTED: histone H4 [Malus domestica] XP_008357...   182   1e-57
AAT08725.1 histone H4 [Hyacinthus orientalis]                         182   1e-57
GAV63738.1 Histone domain-containing protein, partial [Cephalotu...   182   1e-57

>XP_019579115.1 PREDICTED: histone H4-like, partial [Rhinolophus sinicus]
           ACD76815.1 histone 4, partial [Capsella bursa-pastoris]
          Length = 96

 Score =  182 bits (462), Expect = 8e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 1   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 60

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 61  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 92


>JAU24228.1 hypothetical protein GA_TR3665_c2_g1_i1_g.12549, partial [Noccaea
           caerulescens] JAU32731.1 hypothetical protein
           LC_TR11265_c3_g1_i1_g.39648, partial [Noccaea
           caerulescens] JAU69800.1 hypothetical protein
           LE_TR2984_c23_g1_i1_g.9710, partial [Noccaea
           caerulescens] JAU77673.1 hypothetical protein
           MP_TR19714_c5_g1_i1_g.56372, partial [Noccaea
           caerulescens]
          Length = 97

 Score =  182 bits (462), Expect = 8e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 2   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 61

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 62  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 93


>XP_019579135.1 PREDICTED: histone H4-like, partial [Rhinolophus sinicus]
           JAU94214.1 Histone H4, partial [Noccaea caerulescens]
          Length = 99

 Score =  182 bits (462), Expect = 9e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 4   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 63

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 64  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 95


>EYU41919.1 hypothetical protein MIMGU_mgv1a024124mg, partial [Erythranthe
           guttata] JAU37335.1 Histone H4, partial [Noccaea
           caerulescens]
          Length = 100

 Score =  182 bits (462), Expect = 9e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 5   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 64

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 65  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 96


>XP_002862282.1 hypothetical protein ARALYDRAFT_497532 [Arabidopsis lyrata subsp.
           lyrata] XP_002866359.1 hypothetical protein
           ARALYDRAFT_496134 [Arabidopsis lyrata subsp. lyrata]
           EFH38540.1 hypothetical protein ARALYDRAFT_497532,
           partial [Arabidopsis lyrata subsp. lyrata] EFH42618.1
           hypothetical protein ARALYDRAFT_496134, partial
           [Arabidopsis lyrata subsp. lyrata]
          Length = 100

 Score =  182 bits (462), Expect = 9e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>OAY83940.1 Histone H4 [Ananas comosus]
          Length = 102

 Score =  182 bits (462), Expect = 9e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 7   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 66

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 67  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 98


>prf||1101277A histone H4 [Triticum aestivum]
          Length = 102

 Score =  182 bits (462), Expect = 9e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 7   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 66

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 67  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 98


>BAB71814.1 histone H4, partial [Citrus jambhiri]
          Length = 102

 Score =  182 bits (462), Expect = 9e-58
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>XP_020176745.1 histone H4-like [Aegilops tauschii subsp. tauschii]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>XP_011087009.1 PREDICTED: histone H4-like, partial [Sesamum indicum]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>XP_010913656.1 PREDICTED: histone H4-like [Elaeis guineensis]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>ACG31455.1 histone H4 [Zea mays]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>ACG31227.1 histone H4 [Zea mays]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>ACG31208.1 histone H4 [Zea mays]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>ACG30729.1 histone H4 [Zea mays]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>P62786.2 RecName: Full=Histone H4 variant TH091 AAA34292.1 histone H4
           [Triticum aestivum]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>WP_072354057.1 hypothetical protein [Klebsiella pneumoniae] NP_180441.1 histone H4
           [Arabidopsis thaliana] NP_190179.1 Histone superfamily
           protein [Arabidopsis thaliana] NP_190941.1 Histone
           superfamily protein [Arabidopsis thaliana] NP_563793.1
           Histone superfamily protein [Arabidopsis thaliana]
           NP_563797.1 Histone superfamily protein [Arabidopsis
           thaliana] NP_568911.1 Histone superfamily protein
           [Arabidopsis thaliana] NP_568918.1 Histone superfamily
           protein [Arabidopsis thaliana] NP_850939.1 Histone
           superfamily protein [Arabidopsis thaliana] NP_850660.1
           Histone superfamily protein [Arabidopsis thaliana]
           NP_001131585.1 histone H4 [Zea mays] NP_001237495.1
           histone H4 [Glycine max] NP_001278493.1 uncharacterized
           protein LOC100278340 [Zea mays] NP_001281194.1
           uncharacterized protein LOC100282268 [Zea mays]
           NP_001313304.1 histone H4 [Zea mays] NP_001332089.1
           Histone superfamily protein [Arabidopsis thaliana]
           XP_001751729.1 histone H4 [Physcomitrella patens]
           XP_001766349.1 histone H4 [Physcomitrella patens]
           XP_001768203.1 histone H4 [Physcomitrella patens]
           XP_001769691.1 histone H4 [Physcomitrella patens]
           XP_001771124.1 histone H4 [Physcomitrella patens]
           XP_001773584.1 histone H4 [Physcomitrella patens]
           XP_001775783.1 histone H4 [Physcomitrella patens]
           XP_001779524.1 predicted protein [Physcomitrella patens]
           XP_001779981.1 histone H4 [Physcomitrella patens]
           XP_001780443.1 histone H4 [Physcomitrella patens]
           XP_001783818.1 histone H4 [Physcomitrella patens]
           XP_002310853.1 histone H4 family protein [Populus
           trichocarpa] XP_002310855.1 hypothetical protein
           POPTR_0007s14020g [Populus trichocarpa] XP_002310859.1
           histone H4 family protein [Populus trichocarpa]
           XP_002311129.1 histone H4 family protein [Populus
           trichocarpa] XP_002316326.1 hypothetical protein
           POPTR_0010s22090g [Populus trichocarpa] XP_002324472.1
           histone H4 family protein [Populus trichocarpa]
           XP_002324474.1 histone H4 family protein [Populus
           trichocarpa] XP_002325056.1 hypothetical protein
           POPTR_0018s10040g [Populus trichocarpa] XP_002284158.1
           PREDICTED: histone H4 [Vitis vinifera] XP_002284564.1
           PREDICTED: histone H4 [Vitis vinifera] XP_002262845.1
           PREDICTED: histone H4 [Vitis vinifera] XP_002281789.1
           PREDICTED: histone H4 [Vitis vinifera] XP_002465012.1
           hypothetical protein SORBIDRAFT_01g030460 [Sorghum
           bicolor] XP_002468624.1 hypothetical protein
           SORBIDRAFT_01g049250 [Sorghum bicolor] XP_002460250.1
           hypothetical protein SORBIDRAFT_02g025440 [Sorghum
           bicolor] XP_002462803.1 hypothetical protein
           SORBIDRAFT_02g032240 [Sorghum bicolor] XP_002455130.1
           hypothetical protein SORBIDRAFT_03g004840 [Sorghum
           bicolor] XP_002455131.1 hypothetical protein
           SORBIDRAFT_03g004870 [Sorghum bicolor] XP_002456596.1
           hypothetical protein SORBIDRAFT_03g039090 [Sorghum
           bicolor] XP_002457286.1 hypothetical protein
           SORBIDRAFT_03g004890 [Sorghum bicolor] XP_002452743.1
           hypothetical protein SORBIDRAFT_04g031620 [Sorghum
           bicolor] XP_002448395.1 hypothetical protein
           SORBIDRAFT_06g026490 [Sorghum bicolor] XP_002439932.1
           hypothetical protein SORBIDRAFT_09g022920 [Sorghum
           bicolor] XP_002509686.1 PREDICTED: histone H4 [Ricinus
           communis] XP_002518940.1 PREDICTED: histone H4 [Ricinus
           communis] XP_002531654.1 PREDICTED: histone H4 [Ricinus
           communis] XP_002531656.1 PREDICTED: histone H4 [Ricinus
           communis] XP_002532808.1 PREDICTED: histone H4 [Ricinus
           communis] XP_002864647.1 hypothetical protein
           ARALYDRAFT_496101 [Arabidopsis lyrata subsp. lyrata]
           XP_002875757.1 hypothetical protein ARALYDRAFT_484971
           [Arabidopsis lyrata subsp. lyrata] XP_002877481.1
           hypothetical protein ARALYDRAFT_485010 [Arabidopsis
           lyrata subsp. lyrata] XP_002877938.1 hypothetical
           protein ARALYDRAFT_485763 [Arabidopsis lyrata subsp.
           lyrata] XP_002881006.1 hypothetical protein
           ARALYDRAFT_481787 [Arabidopsis lyrata subsp. lyrata]
           XP_003521335.1 PREDICTED: histone H4 [Glycine max]
           XP_003535987.1 PREDICTED: histone H4 [Glycine max]
           XP_003538030.1 PREDICTED: histone H4 [Glycine max]
           XP_003538258.1 PREDICTED: histone H4 [Glycine max]
           XP_003538259.1 PREDICTED: histone H4 [Glycine max]
           XP_003538260.1 PREDICTED: histone H4 [Glycine max]
           XP_003539748.1 PREDICTED: histone H4 [Glycine max]
           XP_003544868.1 PREDICTED: histone H4 [Glycine max]
           XP_003549448.1 PREDICTED: histone H4 [Glycine max]
           XP_003555742.1 PREDICTED: histone H4 [Glycine max]
           XP_003557745.1 PREDICTED: histone H4 [Brachypodium
           distachyon] XP_003557764.1 PREDICTED: histone H4
           [Brachypodium distachyon] XP_003558370.1 PREDICTED:
           histone H4 [Brachypodium distachyon] XP_003558954.1
           PREDICTED: histone H4 [Brachypodium distachyon]
           XP_003578155.1 PREDICTED: histone H4 [Brachypodium
           distachyon] XP_003578603.1 PREDICTED: histone H4
           [Brachypodium distachyon] XP_003597302.1 histone H4
           domain protein [Medicago truncatula] XP_003600460.1
           histone H4 domain protein [Medicago truncatula]
           XP_003600922.1 histone H4 domain protein [Medicago
           truncatula] XP_003606566.1 histone H4 domain protein
           [Medicago truncatula] XP_003615092.1 histone H4 domain
           protein [Medicago truncatula] XP_003625481.1 histone H4
           domain protein [Medicago truncatula] XP_003627802.1
           histone H4 domain protein [Medicago truncatula]
           XP_004138399.1 PREDICTED: histone H4 [Cucumis sativus]
           XP_004143094.1 PREDICTED: histone H4 [Cucumis sativus]
           XP_004143095.1 PREDICTED: histone H4 [Cucumis sativus]
           XP_004143098.1 PREDICTED: histone H4 [Cucumis sativus]
           XP_004143099.1 PREDICTED: histone H4 [Cucumis sativus]
           XP_004143100.1 PREDICTED: histone H4 [Cucumis sativus]
           XP_004294590.1 PREDICTED: histone H4 [Fragaria vesca
           subsp. vesca] XP_004294591.1 PREDICTED: histone H4
           [Fragaria vesca subsp. vesca] XP_004294592.1 PREDICTED:
           histone H4 [Fragaria vesca subsp. vesca] XP_004294628.1
           PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
           XP_004302787.1 PREDICTED: histone H4 [Fragaria vesca
           subsp. vesca] XP_004307447.1 PREDICTED: histone H4
           [Fragaria vesca subsp. vesca] XP_004487047.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004500222.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004505922.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004507853.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004511025.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004513931.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004516180.1 PREDICTED:
           histone H4 [Cicer arietinum] XP_004953471.1 PREDICTED:
           histone H4 [Setaria italica] XP_004956919.1 PREDICTED:
           histone H4 [Setaria italica] XP_004957584.1 PREDICTED:
           histone H4 [Setaria italica] XP_004961797.1 PREDICTED:
           histone H4 [Setaria italica] XP_004970497.1 PREDICTED:
           histone H4 [Setaria italica] XP_004973289.1 PREDICTED:
           histone H4 [Setaria italica] XP_004976597.1 PREDICTED:
           histone H4 [Setaria italica] XP_004983800.1 PREDICTED:
           histone H4 [Setaria italica] XP_004985949.1 PREDICTED:
           histone H4 [Setaria italica] XP_006349012.1 PREDICTED:
           histone H4 [Solanum tuberosum] XP_006279505.1
           hypothetical protein CARUB_v10027423mg [Capsella
           rubella] XP_006292098.1 hypothetical protein
           CARUB_v10018293mg [Capsella rubella] XP_006292099.1
           hypothetical protein CARUB_v10018294mg [Capsella
           rubella] XP_006295294.1 hypothetical protein
           CARUB_v10024384mg [Capsella rubella] XP_006303455.1
           hypothetical protein CARUB_v10010716mg [Capsella
           rubella] XP_006303457.1 hypothetical protein
           CARUB_v10010719mg [Capsella rubella] XP_006383119.1
           hypothetical protein POPTR_0005s11740g [Populus
           trichocarpa] XP_006383122.1 histone H4 family protein
           [Populus trichocarpa] XP_006381806.1 hypothetical
           protein POPTR_0006s18360g [Populus trichocarpa]
           XP_002316375.2 hypothetical protein POPTR_0010s22080g
           [Populus trichocarpa] XP_006417762.1 hypothetical
           protein EUTSA_v10009172mg [Eutrema salsugineum]
           XP_006418920.1 hypothetical protein EUTSA_v10002735mg
           [Eutrema salsugineum] XP_006418982.1 hypothetical
           protein EUTSA_v10002736mg [Eutrema salsugineum]
           XP_006400894.1 hypothetical protein EUTSA_v10016102mg
           [Eutrema salsugineum] XP_006400928.1 hypothetical
           protein EUTSA_v10015098mg [Eutrema salsugineum]
           XP_006403660.1 hypothetical protein EUTSA_v10010851mg
           [Eutrema salsugineum] XP_006409907.1 hypothetical
           protein EUTSA_v10017468mg [Eutrema salsugineum]
           XP_006410944.1 hypothetical protein EUTSA_v10017467mg
           [Eutrema salsugineum] XP_006424714.1 hypothetical
           protein CICLE_v10029643mg [Citrus clementina]
           XP_006424715.1 hypothetical protein CICLE_v10029643mg
           [Citrus clementina] XP_006424783.1 hypothetical protein
           CICLE_v10029640mg [Citrus clementina] XP_006429035.1
           hypothetical protein CICLE_v10013183mg [Citrus
           clementina] XP_006453377.1 hypothetical protein
           CICLE_v10009994mg [Citrus clementina] XP_006474179.1
           PREDICTED: histone H4 [Citrus sinensis] XP_006480778.1
           PREDICTED: histone H4 [Citrus sinensis] XP_006488229.1
           PREDICTED: histone H4 [Citrus sinensis] XP_006488285.1
           PREDICTED: histone H4 [Citrus sinensis] XP_006597302.1
           PREDICTED: histone H4 [Glycine max] XP_006644971.1
           PREDICTED: histone H4 [Oryza brachyantha] XP_006652696.1
           PREDICTED: histone H4 [Oryza brachyantha] XP_006829196.1
           PREDICTED: histone H4 [Amborella trichopoda]
           XP_006841590.1 PREDICTED: histone H4 [Amborella
           trichopoda] XP_006845633.1 PREDICTED: histone H4
           [Amborella trichopoda] XP_006845635.1 PREDICTED: histone
           H4 isoform X1 [Amborella trichopoda] XP_006845637.1
           PREDICTED: histone H4 [Amborella trichopoda]
           XP_006853335.1 PREDICTED: histone H4 [Amborella
           trichopoda] XP_006856158.1 PREDICTED: histone H4
           [Amborella trichopoda] XP_007009385.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007014216.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007016483.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007016577.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007024825.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007027067.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007027069.1 PREDICTED: histone
           H4 [Theobroma cacao] XP_007132137.1 hypothetical protein
           PHAVU_011G069700g [Phaseolus vulgaris] XP_007142236.1
           hypothetical protein PHAVU_008G263800g [Phaseolus
           vulgaris] XP_007146746.1 hypothetical protein
           PHAVU_006G066300g [Phaseolus vulgaris] XP_007146747.1
           hypothetical protein PHAVU_006G066400g [Phaseolus
           vulgaris] XP_007146748.1 hypothetical protein
           PHAVU_006G066400g [Phaseolus vulgaris] XP_007150264.1
           hypothetical protein PHAVU_005G139600g [Phaseolus
           vulgaris] XP_007154766.1 hypothetical protein
           PHAVU_003G145900g [Phaseolus vulgaris] XP_007162656.1
           hypothetical protein PHAVU_001G169200g [Phaseolus
           vulgaris] XP_007202793.1 hypothetical protein
           PRUPE_ppa013787mg [Prunus persica] XP_007206175.1
           hypothetical protein PRUPE_ppa013781mg [Prunus persica]
           XP_007206176.1 hypothetical protein PRUPE_ppa013792mg
           [Prunus persica] XP_007210543.1 hypothetical protein
           PRUPE_ppa013776mg [Prunus persica] XP_007220484.1
           hypothetical protein PRUPE_ppa013779mg [Prunus persica]
           XP_007220485.1 hypothetical protein PRUPE_ppa013782mg
           [Prunus persica] XP_008223213.1 PREDICTED: histone H4
           [Prunus mume] XP_008241245.1 PREDICTED: histone H4
           [Prunus mume] XP_008233523.1 PREDICTED: histone H4
           [Prunus mume] XP_008233524.1 PREDICTED: histone H4
           [Prunus mume] XP_008233596.1 PREDICTED: histone H4
           [Prunus mume] XP_008245808.1 PREDICTED: histone H4
           [Prunus mume] XP_008343545.1 PREDICTED: histone H4
           [Malus domestica] XP_008463901.1 PREDICTED: histone H4
           [Cucumis melo] XP_008448389.1 PREDICTED: histone H4
           [Cucumis melo] XP_008448390.1 PREDICTED: histone H4
           [Cucumis melo] XP_008448391.1 PREDICTED: histone H4
           [Cucumis melo] XP_008448392.1 PREDICTED: histone H4
           [Cucumis melo] XP_008456764.1 PREDICTED: histone H4
           [Cucumis melo] XP_008456765.1 PREDICTED: histone H4
           [Cucumis melo] XP_008650256.1 PREDICTED: histone H4 [Zea
           mays] XP_008668985.1 PREDICTED: histone H4 [Zea mays]
           XP_008673673.1 PREDICTED: histone H4 [Zea mays]
           XP_008674854.1 PREDICTED: histone H4 [Zea mays]
           XP_008656378.1 PREDICTED: histone H4 [Zea mays]
           XP_008657088.1 PREDICTED: histone H4 [Zea mays]
           XP_008804861.1 PREDICTED: histone H4 [Phoenix
           dactylifera] XP_008812450.1 PREDICTED: histone H4
           [Phoenix dactylifera] XP_008781903.1 PREDICTED: histone
           H4 [Phoenix dactylifera] XP_009131981.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009133863.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009140937.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009141673.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009143480.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009148015.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009116068.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009118417.1 PREDICTED:
           histone H4 [Brassica rapa] XP_009337602.1 PREDICTED:
           histone H4 [Pyrus x bretschneideri] XP_009394094.1
           PREDICTED: histone H4 [Musa acuminata subsp.
           malaccensis] XP_009394189.1 PREDICTED: histone H4 [Musa
           acuminata subsp. malaccensis] XP_009401269.1 PREDICTED:
           histone H4 [Musa acuminata subsp. malaccensis]
           XP_009390508.1 PREDICTED: histone H4 [Musa acuminata
           subsp. malaccensis] XP_009394577.1 PREDICTED: histone H4
           [Musa acuminata subsp. malaccensis] XP_009406967.1
           PREDICTED: histone H4 [Musa acuminata subsp.
           malaccensis] XP_009409540.1 PREDICTED: histone H4 [Musa
           acuminata subsp. malaccensis] XP_009414300.1 PREDICTED:
           histone H4 [Musa acuminata subsp. malaccensis]
           XP_009416257.1 PREDICTED: histone H4 [Musa acuminata
           subsp. malaccensis] XP_009420019.1 PREDICTED: histone H4
           [Musa acuminata subsp. malaccensis] XP_009420833.1
           PREDICTED: histone H4 [Musa acuminata subsp.
           malaccensis] XP_009380760.1 PREDICTED: histone H4 [Musa
           acuminata subsp. malaccensis] XP_009382750.1 PREDICTED:
           histone H4 [Musa acuminata subsp. malaccensis]
           XP_009384902.1 PREDICTED: histone H4 [Musa acuminata
           subsp. malaccensis] XP_009607922.1 PREDICTED: histone H4
           [Nicotiana tomentosiformis] XP_009609514.1 PREDICTED:
           histone H4 [Nicotiana tomentosiformis] XP_009591402.1
           PREDICTED: histone H4 [Nicotiana tomentosiformis]
           XP_009600261.1 PREDICTED: histone H4 [Nicotiana
           tomentosiformis] XP_009791880.1 PREDICTED: histone H4
           [Nicotiana sylvestris] XP_009794491.1 PREDICTED: histone
           H4 [Nicotiana sylvestris] XP_009798388.1 PREDICTED:
           histone H4 [Nicotiana sylvestris] XP_009757026.1
           PREDICTED: histone H4 [Nicotiana sylvestris]
           XP_009767266.1 PREDICTED: histone H4 [Nicotiana
           sylvestris] XP_009777185.1 PREDICTED: histone H4
           [Nicotiana sylvestris] XP_010030574.1 PREDICTED: histone
           H4 [Eucalyptus grandis] XP_010053044.1 PREDICTED:
           histone H4 [Eucalyptus grandis] XP_010056038.1
           PREDICTED: histone H4 [Eucalyptus grandis]
           XP_010033143.1 PREDICTED: histone H4 [Eucalyptus
           grandis] XP_010037716.1 PREDICTED: histone H4
           [Eucalyptus grandis] XP_010037848.1 PREDICTED: histone
           H4 [Eucalyptus grandis] XP_010092782.1 Histone H4 [Morus
           notabilis] XP_010093009.1 Histone H4 [Morus notabilis]
           XP_010104910.1 Histone H4 [Morus notabilis]
           XP_010263120.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010264531.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010264574.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010262272.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010262273.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010262275.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010262276.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010246201.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010246202.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010246203.1 PREDICTED: histone H4 [Nelumbo nucifera]
           XP_010231275.1 PREDICTED: histone H4 [Brachypodium
           distachyon] XP_010313299.1 PREDICTED: histone H4
           [Solanum lycopersicum] XP_010455395.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010455780.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010487799.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010488030.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010503204.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010503249.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010504143.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010510587.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010514915.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010514961.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010515874.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010426021.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010426070.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010427032.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010443740.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010443785.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010457960.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010457961.1 PREDICTED: histone
           H4 [Camelina sativa] XP_010457987.1 PREDICTED: histone
           H4 isoform X2 [Camelina sativa] XP_010457988.1
           PREDICTED: histone H4 isoform X1 [Camelina sativa]
           XP_010475534.1 PREDICTED: histone H4 [Camelina sativa]
           XP_010475535.1 PREDICTED: histone H4 [Camelina sativa]
           XP_010475557.1 PREDICTED: histone H4 [Camelina sativa]
           XP_010483612.1 PREDICTED: histone H4 [Camelina sativa]
           XP_010541393.1 PREDICTED: histone H4 [Tarenaya
           hassleriana] XP_010542611.1 PREDICTED: histone H4
           [Tarenaya hassleriana] XP_010542654.1 PREDICTED: histone
           H4 [Tarenaya hassleriana] XP_010557281.1 PREDICTED:
           histone H4 [Tarenaya hassleriana] XP_010557296.1
           PREDICTED: histone H4 [Tarenaya hassleriana]
           XP_010520287.1 PREDICTED: histone H4 [Tarenaya
           hassleriana] XP_010520288.1 PREDICTED: histone H4
           [Tarenaya hassleriana] XP_010521821.1 PREDICTED: histone
           H4 [Tarenaya hassleriana] XP_010521900.1 PREDICTED:
           histone H4 [Tarenaya hassleriana] XP_010680743.1
           PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
           XP_010672778.1 PREDICTED: histone H4 [Beta vulgaris
           subsp. vulgaris] XP_010685810.1 PREDICTED: histone H4
           [Beta vulgaris subsp. vulgaris] XP_010693814.1
           PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
           XP_010695592.1 PREDICTED: histone H4 [Beta vulgaris
           subsp. vulgaris] XP_010695599.1 PREDICTED: histone H4
           [Beta vulgaris subsp. vulgaris] XP_010913659.1
           PREDICTED: histone H4 [Elaeis guineensis] XP_010914145.1
           PREDICTED: histone H4 [Elaeis guineensis] XP_011018258.1
           PREDICTED: histone H4 [Populus euphratica]
           XP_011018338.1 PREDICTED: histone H4 [Populus
           euphratica] XP_010920757.1 PREDICTED: histone H4 [Elaeis
           guineensis] XP_010928661.1 PREDICTED: histone H4 [Elaeis
           guineensis] XP_010935331.1 PREDICTED: histone H4 [Elaeis
           guineensis] XP_011025936.1 PREDICTED: histone H4
           [Populus euphratica] XP_011025939.1 PREDICTED: histone
           H4 [Populus euphratica] XP_011025955.1 PREDICTED:
           histone H4 [Populus euphratica] XP_010937748.1
           PREDICTED: histone H4 [Elaeis guineensis] XP_011027073.1
           PREDICTED: histone H4 [Populus euphratica]
           XP_010940230.1 PREDICTED: histone H4 [Elaeis guineensis]
           XP_010907491.1 PREDICTED: histone H4 [Elaeis guineensis]
           XP_011043210.1 PREDICTED: histone H4 [Populus
           euphratica] XP_011043213.1 PREDICTED: histone H4
           [Populus euphratica] XP_011043969.1 PREDICTED: histone
           H4 [Populus euphratica] XP_011043970.1 PREDICTED:
           histone H4 isoform X1 [Populus euphratica]
           XP_011043971.1 PREDICTED: histone H4 isoform X2 [Populus
           euphratica] XP_011043972.1 PREDICTED: histone H4 isoform
           X3 [Populus euphratica] XP_011009519.1 PREDICTED:
           histone H4 [Populus euphratica] XP_011013668.1
           PREDICTED: histone H4 [Populus euphratica]
           XP_011013671.1 PREDICTED: histone H4 [Populus
           euphratica] XP_011076639.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011077456.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011077544.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011084861.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011085966.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011089394.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011094841.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011095029.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011095589.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011097720.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011101872.1 PREDICTED: histone H4
           [Sesamum indicum] XP_011469720.1 PREDICTED: histone H4
           [Fragaria vesca subsp. vesca] XP_011469723.1 PREDICTED:
           histone H4 [Fragaria vesca subsp. vesca] XP_011623050.1
           PREDICTED: histone H4 [Amborella trichopoda]
           XP_011623051.1 PREDICTED: histone H4 [Amborella
           trichopoda] XP_011622317.1 PREDICTED: histone H4
           [Amborella trichopoda] XP_011653471.1 PREDICTED: histone
           H4 [Cucumis sativus] XP_012065002.1 PREDICTED: histone
           H4 [Jatropha curcas] XP_012074058.1 PREDICTED: histone
           H4 [Jatropha curcas] XP_012087028.1 PREDICTED: histone
           H4 [Jatropha curcas] XP_012087045.1 PREDICTED: histone
           H4 [Jatropha curcas] XP_012468389.1 PREDICTED: histone
           H4 [Gossypium raimondii] XP_012469798.1 PREDICTED:
           histone H4 [Gossypium raimondii] XP_012471384.1
           PREDICTED: histone H4 [Gossypium raimondii]
           XP_012471433.1 PREDICTED: histone H4 [Gossypium
           raimondii] XP_012472789.1 PREDICTED: histone H4
           [Gossypium raimondii] XP_012472799.1 PREDICTED: histone
           H4 [Gossypium raimondii] XP_012441522.1 PREDICTED:
           histone H4 [Gossypium raimondii] XP_012442871.1
           PREDICTED: histone H4 [Gossypium raimondii]
           XP_012456440.1 PREDICTED: histone H4 [Gossypium
           raimondii] XP_012460773.1 PREDICTED: histone H4
           [Gossypium raimondii] XP_012461907.1 PREDICTED: histone
           H4 [Gossypium raimondii] XP_012465147.1 PREDICTED:
           histone H4 [Gossypium raimondii] XP_012831997.1
           PREDICTED: histone H4 [Erythranthe guttata]
           XP_012832191.1 PREDICTED: histone H4 [Erythranthe
           guttata] XP_012841834.1 PREDICTED: histone H4
           [Erythranthe guttata] XP_012848703.1 PREDICTED: histone
           H4 [Erythranthe guttata] XP_012850355.1 PREDICTED:
           histone H4 [Erythranthe guttata] XP_012850464.1
           PREDICTED: histone H4 [Erythranthe guttata]
           XP_012850911.1 PREDICTED: histone H4 [Erythranthe
           guttata] XP_012858790.1 PREDICTED: histone H4
           [Erythranthe guttata] XP_012827931.1 PREDICTED: histone
           H4 [Erythranthe guttata] XP_013448040.1 histone H4
           domain protein [Medicago truncatula] XP_013456049.1
           histone H4 domain protein [Medicago truncatula]
           XP_013459905.1 histone H4 domain protein [Medicago
           truncatula] XP_013460127.1 histone H4 domain protein
           [Medicago truncatula] XP_013460128.1 histone H4 domain
           protein [Medicago truncatula] XP_013460134.1 histone H4
           domain protein [Medicago truncatula] XP_013460151.1
           histone H4 domain protein [Medicago truncatula]
           XP_013615993.1 PREDICTED: histone H4 [Brassica oleracea
           var. oleracea] XP_013622579.1 PREDICTED: histone H4
           [Brassica oleracea var. oleracea] XP_013623511.1
           PREDICTED: histone H4 [Brassica oleracea var. oleracea]
           XP_013625358.1 PREDICTED: histone H4 [Brassica oleracea
           var. oleracea] XP_013630704.1 PREDICTED: histone H4
           [Brassica oleracea var. oleracea] XP_013631522.1
           PREDICTED: histone H4 [Brassica oleracea var. oleracea]
           XP_013632073.1 PREDICTED: histone H4 [Brassica oleracea
           var. oleracea] XP_013633957.1 PREDICTED: histone H4
           [Brassica oleracea var. oleracea] XP_013637962.1
           PREDICTED: histone H4 [Brassica oleracea var. oleracea]
           XP_013583915.1 PREDICTED: histone H4 [Brassica oleracea
           var. oleracea] XP_013588638.1 PREDICTED: histone H4
           [Brassica oleracea var. oleracea] XP_013600442.1
           PREDICTED: histone H4 [Brassica oleracea var. oleracea]
           XP_013602591.1 PREDICTED: histone H4 [Brassica oleracea
           var. oleracea] XP_013605168.1 PREDICTED: histone H4
           [Brassica oleracea var. oleracea] XP_013702039.1
           PREDICTED: histone H4 [Brassica napus] XP_013680780.1
           PREDICTED: histone H4 isoform X1 [Brassica napus]
           XP_013680787.1 PREDICTED: histone H4 isoform X2
           [Brassica napus] XP_013681707.1 PREDICTED: histone H4
           [Brassica napus] XP_013689098.1 PREDICTED: histone H4
           [Brassica napus] XP_013732634.1 PREDICTED: histone H4
           [Brassica napus] XP_013734919.1 PREDICTED: histone H4
           [Brassica napus] XP_013738370.1 PREDICTED: histone H4
           [Brassica napus] XP_013744194.1 PREDICTED: histone H4
           [Brassica napus] XP_013744725.1 PREDICTED: histone H4
           [Brassica napus] XP_013748348.1 PREDICTED: histone H4
           [Brassica napus] XP_013641146.1 PREDICTED: histone H4
           [Brassica napus] XP_013641159.1 PREDICTED: histone H4
           [Brassica napus] XP_013642542.1 PREDICTED: histone H4
           [Brassica napus] XP_013647689.1 PREDICTED: histone H4
           [Brassica napus] XP_013657574.1 PREDICTED: histone H4
           [Brassica napus] XP_013661167.1 PREDICTED: histone H4
           [Brassica napus] XP_013676426.1 PREDICTED: histone H4
           [Brassica napus] XP_013678307.1 PREDICTED: histone H4
           [Brassica napus] XP_013691794.1 PREDICTED: histone H4
           [Brassica napus] XP_013695902.1 PREDICTED: histone H4
           [Brassica napus] XP_013699203.1 PREDICTED: histone H4
           [Brassica napus] XP_013708064.1 PREDICTED: histone H4
           [Brassica napus] XP_013708232.1 PREDICTED: histone H4
           [Brassica napus] XP_013716269.1 PREDICTED: histone H4
           [Brassica napus] XP_013723951.1 PREDICTED: histone H4
           [Brassica napus] XP_013729484.1 PREDICTED: histone H4
           [Brassica napus] XP_013733729.1 PREDICTED: histone H4
           [Brassica napus] XP_014493889.1 PREDICTED: histone H4
           [Vigna radiata var. radiata] XP_014494409.1 PREDICTED:
           histone H4 [Vigna radiata var. radiata] XP_014494432.1
           PREDICTED: histone H4 [Vigna radiata var. radiata]
           XP_014496235.1 PREDICTED: histone H4 [Vigna radiata var.
           radiata] XP_014498124.1 PREDICTED: histone H4 [Vigna
           radiata var. radiata] XP_014505099.1 PREDICTED: histone
           H4 [Vigna radiata var. radiata] XP_014518271.1
           PREDICTED: histone H4 [Vigna radiata var. radiata]
           XP_014624656.1 PREDICTED: histone H4 [Glycine max]
           XP_003542580.3 PREDICTED: histone H4 [Glycine max]
           XP_003551292.3 PREDICTED: histone H4 [Glycine max]
           XP_014755701.1 PREDICTED: histone H4 [Brachypodium
           distachyon] XP_014758281.1 PREDICTED: histone H4
           [Brachypodium distachyon] XP_015057055.1 PREDICTED:
           histone H4 [Solanum pennellii] XP_015578392.1 PREDICTED:
           histone H4 [Ricinus communis] XP_015612982.1 PREDICTED:
           histone H4 [Oryza sativa Japonica Group] XP_015627403.1
           PREDICTED: histone H4 [Oryza sativa Japonica Group]
           XP_015628561.1 PREDICTED: histone H4 [Oryza sativa
           Japonica Group] XP_015636819.1 PREDICTED: histone H4
           [Oryza sativa Japonica Group] XP_015637997.1 PREDICTED:
           histone H4 [Oryza sativa Japonica Group] XP_015639309.1
           PREDICTED: histone H4 [Oryza sativa Japonica Group]
           XP_015645242.1 PREDICTED: histone H4 [Oryza sativa
           Japonica Group] XP_015610672.1 PREDICTED: histone H4
           [Oryza sativa Japonica Group] XP_015612705.1 PREDICTED:
           histone H4 [Oryza sativa Japonica Group] XP_015614455.1
           PREDICTED: histone H4 [Oryza sativa Japonica Group]
           XP_015697325.1 PREDICTED: histone H4 [Oryza brachyantha]
           XP_015900237.1 PREDICTED: histone H4 [Ziziphus jujuba]
           XP_015874145.1 PREDICTED: histone H4 [Ziziphus jujuba]
           XP_015876988.1 PREDICTED: histone H4 [Ziziphus jujuba]
           XP_015877066.1 PREDICTED: histone H4 [Ziziphus jujuba]
           XP_015901777.1 PREDICTED: histone H4 [Ziziphus jujuba]
           XP_015933867.1 PREDICTED: histone H4 [Arachis
           duranensis] XP_015949070.1 PREDICTED: histone H4
           [Arachis duranensis] XP_015949071.1 PREDICTED: histone
           H4 [Arachis duranensis] XP_015949133.1 PREDICTED:
           histone H4 [Arachis duranensis] XP_015956746.1
           PREDICTED: histone H4 [Arachis duranensis]
           XP_015958826.1 PREDICTED: histone H4 [Arachis
           duranensis] XP_015932139.1 PREDICTED: histone H4
           [Arachis duranensis] XP_016201174.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016201187.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016201198.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016183210.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016183212.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016183239.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016190129.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016197256.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016166903.1 PREDICTED: histone
           H4 [Arachis ipaensis] XP_016452786.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016455516.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016459669.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016475587.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016476748.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016477054.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016483711.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016491075.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016497947.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016501198.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016501825.1 PREDICTED: histone
           H4 [Nicotiana tabacum] XP_016575872.1 PREDICTED: histone
           H4 [Capsicum annuum] XP_016719940.1 PREDICTED: histone
           H4 [Gossypium hirsutum] XP_016719943.1 PREDICTED:
           histone H4 [Gossypium hirsutum] XP_016727035.1
           PREDICTED: histone H4 [Gossypium hirsutum]
           XP_016727067.1 PREDICTED: histone H4 isoform X1
           [Gossypium hirsutum] XP_016727068.1 PREDICTED: histone
           H4 isoform X2 [Gossypium hirsutum] XP_016718727.1
           PREDICTED: histone H4 [Gossypium hirsutum]
           XP_016720273.1 PREDICTED: histone H4 [Gossypium
           hirsutum] XP_016749120.1 PREDICTED: histone H4
           [Gossypium hirsutum] XP_016750530.1 PREDICTED: histone
           H4 [Gossypium hirsutum] XP_016665187.1 PREDICTED:
           histone H4 [Gossypium hirsutum] XP_016665209.1
           PREDICTED: histone H4 [Gossypium hirsutum]
           XP_016697953.1 PREDICTED: histone H4 [Gossypium
           hirsutum] XP_016739036.1 PREDICTED: histone H4
           [Gossypium hirsutum] XP_016740566.1 PREDICTED: histone
           H4 [Gossypium hirsutum] XP_016740603.1 PREDICTED:
           histone H4 [Gossypium hirsutum] XP_016740787.1
           PREDICTED: histone H4 [Gossypium hirsutum]
           XP_017232728.1 PREDICTED: histone H4 [Daucus carota
           subsp. sativus] XP_017235819.1 PREDICTED: histone H4
           [Daucus carota subsp. sativus] XP_017235820.1 PREDICTED:
           histone H4 [Daucus carota subsp. sativus] XP_017235821.1
           PREDICTED: histone H4 [Daucus carota subsp. sativus]
           XP_017244001.1 PREDICTED: histone H4 [Daucus carota
           subsp. sativus] XP_017244283.1 PREDICTED: histone H4
           [Daucus carota subsp. sativus] XP_017244627.1 PREDICTED:
           histone H4 [Daucus carota subsp. sativus] XP_017244681.1
           PREDICTED: histone H4 [Daucus carota subsp. sativus]
           XP_017248895.1 PREDICTED: histone H4 [Daucus carota
           subsp. sativus] XP_017250137.1 PREDICTED: histone H4
           [Daucus carota subsp. sativus] XP_017251355.1 PREDICTED:
           histone H4 [Daucus carota subsp. sativus] XP_017221901.1
           PREDICTED: histone H4 [Daucus carota subsp. sativus]
           XP_017221902.1 PREDICTED: histone H4 [Daucus carota
           subsp. sativus] XP_017406841.1 PREDICTED: histone H4
           [Vigna angularis] XP_017409675.1 PREDICTED: histone H4
           [Vigna angularis] XP_017410781.1 PREDICTED: histone H4
           [Vigna angularis] XP_017425797.1 PREDICTED: histone H4
           [Vigna angularis] XP_017425798.1 PREDICTED: histone H4
           [Vigna angularis] XP_017431445.1 PREDICTED: histone H4
           [Vigna angularis] XP_017432606.1 PREDICTED: histone H4
           [Vigna angularis] XP_017432919.1 PREDICTED: histone H4
           [Vigna angularis] XP_017436612.1 PREDICTED: histone H4
           [Vigna angularis] XP_017436614.1 PREDICTED: histone H4
           [Vigna angularis] XP_017606882.1 PREDICTED: histone H4
           [Gossypium arboreum] XP_017612737.1 PREDICTED: histone
           H4 [Gossypium arboreum] XP_017619881.1 PREDICTED:
           histone H4 [Gossypium arboreum] XP_017617154.1
           PREDICTED: histone H4 [Gossypium arboreum]
           XP_017619313.1 PREDICTED: histone H4 [Gossypium
           arboreum] XP_017623963.1 PREDICTED: histone H4
           [Gossypium arboreum] XP_017638499.1 PREDICTED: histone
           H4 [Gossypium arboreum] XP_017639016.1 PREDICTED:
           histone H4 [Gossypium arboreum] XP_017639068.1
           PREDICTED: histone H4 [Gossypium arboreum]
           XP_017643271.1 PREDICTED: histone H4 [Gossypium
           arboreum] XP_017644832.1 PREDICTED: histone H4
           [Gossypium arboreum] XP_017647212.1 PREDICTED: histone
           H4 [Gossypium arboreum] XP_017985006.1 PREDICTED:
           histone H4 [Theobroma cacao] XP_018466002.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018489416.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018450669.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018473023.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018474564.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018478486.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018486629.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018490753.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018434873.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018436511.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018439064.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018450799.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018450800.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018463191.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018465955.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018465956.1 PREDICTED:
           histone H4 [Raphanus sativus] XP_018623612.1 PREDICTED:
           histone H4 [Nicotiana tomentosiformis] XP_018836019.1
           PREDICTED: histone H4 [Juglans regia] XP_018842042.1
           PREDICTED: histone H4 [Juglans regia] XP_018854792.1
           PREDICTED: histone H4 [Juglans regia] XP_018859994.1
           PREDICTED: histone H4 [Juglans regia] XP_018859999.1
           PREDICTED: histone H4 [Juglans regia] XP_018823320.1
           PREDICTED: histone H4 [Juglans regia] XP_018824592.1
           PREDICTED: histone H4 [Juglans regia] XP_018831351.1
           PREDICTED: histone H4 isoform X1 [Juglans regia]
           XP_018831352.1 PREDICTED: histone H4 isoform X2 [Juglans
           regia] XP_019080189.1 PREDICTED: histone H4 [Vitis
           vinifera] XP_019108317.1 PREDICTED: histone H4 [Beta
           vulgaris subsp. vulgaris] XP_019091613.1 PREDICTED:
           histone H4 isoform X3 [Camelina sativa] XP_019177310.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019178794.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019192695.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019199555.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019199556.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019199558.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019199568.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019164344.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019164404.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019164405.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019164409.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019164410.1
           PREDICTED: histone H4 [Ipomoea nil] XP_019258070.1
           PREDICTED: histone H4 [Nicotiana attenuata]
           XP_019263034.1 PREDICTED: histone H4 [Nicotiana
           attenuata] XP_019266516.1 PREDICTED: histone H4
           [Nicotiana attenuata] XP_019224160.1 PREDICTED: histone
           H4 [Nicotiana attenuata] XP_019224162.1 PREDICTED:
           histone H4 [Nicotiana attenuata] XP_019228913.1
           PREDICTED: histone H4 [Nicotiana attenuata]
           XP_019230718.1 PREDICTED: histone H4 [Nicotiana
           attenuata] XP_019231939.1 PREDICTED: histone H4
           [Nicotiana attenuata] XP_019237410.1 PREDICTED: histone
           H4 [Nicotiana attenuata] XP_019256679.1 PREDICTED:
           histone H4 [Nicotiana attenuata] XP_019256680.1
           PREDICTED: histone H4 [Nicotiana attenuata]
           XP_019454345.1 PREDICTED: histone H4 [Lupinus
           angustifolius] XP_019457387.1 PREDICTED: histone H4
           [Lupinus angustifolius] XP_019457388.1 PREDICTED:
           histone H4 [Lupinus angustifolius] XP_019459107.1
           PREDICTED: histone H4 [Lupinus angustifolius]
           XP_019460698.1 PREDICTED: histone H4 [Lupinus
           angustifolius] XP_019464757.1 PREDICTED: histone H4
           [Lupinus angustifolius] XP_019416384.1 PREDICTED:
           histone H4 [Lupinus angustifolius] XP_019417437.1
           PREDICTED: histone H4 [Lupinus angustifolius]
           XP_019426269.1 PREDICTED: histone H4 [Lupinus
           angustifolius] XP_019426607.1 PREDICTED: histone H4
           [Lupinus angustifolius] XP_019440955.1 PREDICTED:
           histone H4 [Lupinus angustifolius] XP_019440956.1
           PREDICTED: histone H4 [Lupinus angustifolius]
           XP_019440957.1 PREDICTED: histone H4 [Lupinus
           angustifolius] XP_019444402.1 PREDICTED: histone H4
           [Lupinus angustifolius] XP_019448676.1 PREDICTED:
           histone H4 [Lupinus angustifolius] XP_019448677.1
           PREDICTED: histone H4 [Lupinus angustifolius]
           XP_019453594.1 PREDICTED: histone H4 [Lupinus
           angustifolius] XP_019455688.1 PREDICTED: histone H4
           [Lupinus angustifolius] XP_019579043.1 PREDICTED:
           histone H4 [Rhinolophus sinicus] XP_019579075.1
           PREDICTED: histone H4 [Rhinolophus sinicus]
           XP_019579104.1 PREDICTED: histone H4 [Rhinolophus
           sinicus] XP_019702445.1 PREDICTED: histone H4 [Elaeis
           guineensis] XP_020080562.1 histone H4 [Ananas comosus]
           XP_020083540.1 histone H4 [Ananas comosus]
           XP_020084450.1 histone H4 [Ananas comosus]
           XP_020085925.1 histone H4 [Ananas comosus]
           XP_020091513.1 histone H4 [Ananas comosus]
           XP_020093856.1 histone H4 [Ananas comosus]
           XP_020103264.1 histone H4 [Ananas comosus]
           XP_020113492.1 histone H4 [Ananas comosus]
           XP_020114137.1 histone H4 [Ananas comosus]
           XP_020197329.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020146241.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020153967.1 histone H4 [Aegilops
           tauschii subsp. tauschii] XP_020160641.1 histone H4
           [Aegilops tauschii subsp. tauschii] XP_020176722.1
           histone H4 [Aegilops tauschii subsp. tauschii]
           XP_020177269.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020180110.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020183599.1 histone H4 [Aegilops
           tauschii subsp. tauschii] XP_020183604.1 histone H4
           [Aegilops tauschii subsp. tauschii] XP_020183951.1
           histone H4 [Aegilops tauschii subsp. tauschii]
           XP_020186569.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020189180.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020189184.1 histone H4 [Aegilops
           tauschii subsp. tauschii] XP_020189186.1 histone H4
           [Aegilops tauschii subsp. tauschii] XP_020190975.1
           histone H4 [Aegilops tauschii subsp. tauschii]
           XP_020195819.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020195820.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020195821.1 histone H4 [Aegilops
           tauschii subsp. tauschii] XP_020199877.1 histone H4
           [Aegilops tauschii subsp. tauschii] XP_020200225.1
           histone H4 [Aegilops tauschii subsp. tauschii]
           XP_020201075.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020146435.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020147506.1 histone H4 [Aegilops
           tauschii subsp. tauschii] XP_020161978.1 histone H4
           [Aegilops tauschii subsp. tauschii] XP_020162652.1
           histone H4 [Aegilops tauschii subsp. tauschii]
           XP_020164571.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020164951.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020165875.1 histone H4 [Aegilops
           tauschii subsp. tauschii] XP_020165901.1 histone H4
           [Aegilops tauschii subsp. tauschii] XP_020166659.1
           histone H4 [Aegilops tauschii subsp. tauschii]
           XP_020172790.1 histone H4 [Aegilops tauschii subsp.
           tauschii] XP_020176330.1 histone H4 [Aegilops tauschii
           subsp. tauschii] XP_020176567.1 histone H4 [Aegilops
           tauschii subsp. tauschii] P59259.2 RecName: Full=Histone
           H4 Q6LAF3.3 RecName: Full=Histone H4 Q6PMI5.3 RecName:
           Full=Histone H4 Q6WZ83.3 RecName: Full=Histone H4
           Q76H85.3 RecName: Full=Histone H4 P62788.2 RecName:
           Full=Histone H4 P62787.2 RecName: Full=Histone H4
           P62887.2 RecName: Full=Histone H4 P62785.2 RecName:
           Full=Histone H4 variant TH011 P0CG89.1 RecName:
           Full=Histone H4 AAF75072.1 Identical to histone H4 from
           Arabidopsis thaliana gi|S06904 [Arabidopsis thaliana]
           AAF75089.1 Identical to histone H4 from Arabidopsis
           thaliana gi|S06904 [Arabidopsis thaliana] AAG40410.1
           AT5g59690 [Arabidopsis thaliana] AAG46106.1 histone H4
           [Oryza sativa Japonica Group] AAG50107.1 putative
           histone H4 protein [Arabidopsis thaliana] CAA24924.1
           unnamed protein product [Triticum aestivum] AAA32810.1
           histone H4 [Arabidopsis thaliana] AAA32811.1 histone H4
           [Arabidopsis thaliana] AAA33474.1 histone H4 (H4C13)
           [Zea mays] AAA33475.1 histone H4 [Zea mays] AAA33476.1
           histone H4 [Zea mays] AAA86948.1 histone H4 homolog
           [Pisum sativum] CAB01914.1 histone H4 homologue
           [Sesbania rostrata] AAC79580.1 histone H4 [Arabidopsis
           thaliana] BAA85120.1 histone H4-like protein [Solanum
           melongena] CAB62023.1 histone H4-like protein
           [Arabidopsis thaliana] CAB82817.1 Histone H4-like
           protein [Arabidopsis thaliana] CAB88335.1 histone
           H4-like protein [Arabidopsis thaliana] BAB08365.1
           histone H4 [Arabidopsis thaliana] BAB09507.1 histone H4
           [Arabidopsis thaliana] CAC34411.1 histone H4 [Flaveria
           trinervia] AAL14404.1 AT5g59690/mth12_90 [Arabidopsis
           thaliana] AAL32795.1 histone H4-like protein
           [Arabidopsis thaliana] AAL36213.1 putative histone H4
           protein [Arabidopsis thaliana] BAB89744.1 histone H4
           [Oryza sativa Japonica Group] AAM15445.1 histone H4
           [Arabidopsis thaliana] AAM13352.1 histone H4-like
           protein [Arabidopsis thaliana] AAM20526.1 histone
           H4-like protein [Arabidopsis thaliana] AAM61726.1
           histone H4-like protein [Arabidopsis thaliana]
           AAM62721.1 histone H4-like protein [Arabidopsis
           thaliana] AAM63175.1 histone H4-like protein
           [Arabidopsis thaliana] AAM63839.1 histone H4-like
           protein [Arabidopsis thaliana] AAM64264.1 histone
           H4-like protein [Arabidopsis thaliana] AAM64622.1
           histone H4-like protein [Arabidopsis thaliana]
           AAM64744.1 histone H4-like protein [Arabidopsis
           thaliana] AAM70545.1 AT5g59690/mth12_90 [Arabidopsis
           thaliana] AAM91255.1 histone H4-like protein
           [Arabidopsis thaliana] AAM93740.1 histone H4 [Oryza
           sativa Japonica Group] AAN13189.1 putative histone H4
           protein [Arabidopsis thaliana] AAO15293.1 Unknown
           protein [Oryza sativa Japonica Group] BAC56852.1 histone
           H4 [Silene latifolia] AAO41978.1 putative histone H4
           protein [Arabidopsis thaliana] AAO44010.1 At1g07820
           [Arabidopsis thaliana] BAC57734.1 histone H4 [Oryza
           sativa Japonica Group] AAO50503.1 putative histone H4
           protein [Arabidopsis thaliana] AAP33088.1 histone H4
           [Eucalyptus globulus] AAP54838.1 Histone H4, putative,
           expressed [Oryza sativa Japonica Group] CAD41377.2
           OSJNBa0088A01.17 [Oryza sativa Japonica Group]
           BAD07563.1 histone H4 [Oryza sativa Japonica Group]
           AAT01924.1 histone H4 [Chelidonium majus] AAT39190.1
           putative histone H4 [Oryza sativa Japonica Group]
           AAT58763.1 histone H4 [Oryza sativa Japonica Group]
           AAT58785.1 histone H4 [Oryza sativa Japonica Group]
           BAD27874.1 histone H4 [Oryza sativa Japonica Group]
           BAD33556.1 histone H4 [Oryza sativa Japonica Group]
           BAD43276.1 histone H4 [Arabidopsis thaliana] BAD43606.1
           histone H4 [Arabidopsis thaliana] BAD43910.1 histone H4
           [Arabidopsis thaliana] AAU90170.1 histone H4 [Oryza
           sativa Japonica Group] BAD82897.1 histone H4, partial
           [Fragaria x ananassa] AAX92702.1 histone 4 [Picea abies]
           ABD28289.1 histone H4-like protein [Glycine max]
           ABD38885.1 At3g45930 [Arabidopsis thaliana] ABE87620.1
           Histone core [Medicago truncatula] ABF93682.1 Histone
           H4, putative, expressed [Oryza sativa Japonica Group]
           BAF01106.1 Histone H4 - like protein [Arabidopsis
           thaliana] BAF00179.1 histone H4 [Arabidopsis thaliana]
           BAF09676.1 Os02g0684500 [Oryza sativa Japonica Group]
           BAF10697.1 Os03g0119900 [Oryza sativa Japonica Group]
           BAF15578.1 Os04g0583600 [Oryza sativa Japonica Group]
           BAF17683.1 Os05g0462700 [Oryza sativa Japonica Group]
           BAF17700.1 Os05g0466600 [Oryza sativa Japonica Group]
           BAF25159.1 Os09g0433600 [Oryza sativa Japonica Group]
           BAF25792.1 Os09g0553100 [Oryza sativa Japonica Group]
           BAF27093.1 Os10g0539500 [Oryza sativa Japonica Group]
           ABK20879.1 unknown [Picea sitchensis] ABK22619.1 unknown
           [Picea sitchensis] ABK24738.1 unknown [Picea sitchensis]
           ABK26777.1 unknown [Picea sitchensis] ABK93286.1 unknown
           [Populus trichocarpa] ABK94246.1 unknown [Populus
           trichocarpa] ABK94634.1 unknown [Populus trichocarpa]
           ABN08909.1 Histone core [Medicago truncatula] EAY76410.1
           hypothetical protein OsI_04340 [Oryza sativa Indica
           Group] EAY79363.1 hypothetical protein OsI_34491 [Oryza
           sativa Indica Group] EAY87099.1 hypothetical protein
           OsI_08497 [Oryza sativa Indica Group] EAY88304.1
           hypothetical protein OsI_09762 [Oryza sativa Indica
           Group] EAY95298.1 hypothetical protein OsI_17123 [Oryza
           sativa Indica Group] EAY98337.1 hypothetical protein
           OsI_20247 [Oryza sativa Indica Group] EAY98358.1
           hypothetical protein OsI_20269 [Oryza sativa Indica
           Group] EAZ04270.1 hypothetical protein OsI_26413 [Oryza
           sativa Indica Group] EAZ09209.1 hypothetical protein
           OsI_31484 [Oryza sativa Indica Group] EAZ10018.1
           hypothetical protein OsI_32321 [Oryza sativa Indica
           Group] EAZ14069.1 hypothetical protein OsJ_03994 [Oryza
           sativa Japonica Group] EAZ16833.1 hypothetical protein
           OsJ_32304 [Oryza sativa Japonica Group] EAZ24208.1
           hypothetical protein OsJ_07955 [Oryza sativa Japonica
           Group] EAZ25381.1 hypothetical protein OsJ_09199 [Oryza
           sativa Japonica Group] EAZ31763.1 hypothetical protein
           OsJ_15915 [Oryza sativa Japonica Group] EAZ40221.1
           hypothetical protein OsJ_24666 [Oryza sativa Japonica
           Group] EAZ45602.1 hypothetical protein OsJ_30268 [Oryza
           sativa Japonica Group] ABQ32303.1 putative histone
           H4-like protein [Artemisia annua] CAN64268.1
           hypothetical protein VITISV_036365 [Vitis vinifera]
           CAN59705.1 hypothetical protein VITISV_010247, partial
           [Vitis vinifera] CAN59706.1 hypothetical protein
           VITISV_010248 [Vitis vinifera] CAN68239.1 hypothetical
           protein VITISV_006985 [Vitis vinifera] CAN63143.1
           hypothetical protein VITISV_034577 [Vitis vinifera]
           CAN79580.1 hypothetical protein VITISV_002271 [Vitis
           vinifera] CAN79581.1 hypothetical protein VITISV_002272
           [Vitis vinifera] CAN79612.1 hypothetical protein
           VITISV_035467 [Vitis vinifera] CAN79680.1 hypothetical
           protein VITISV_034640 [Vitis vinifera] CAN83554.1
           hypothetical protein VITISV_030356 [Vitis vinifera]
           ABW81095.1 H4his18 [Tarenaya spinosa] EDQ51358.1 histone
           H4 [Physcomitrella patens] EDQ54733.1 histone H4
           [Physcomitrella patens] EDQ55190.1 histone H4
           [Physcomitrella patens] EDQ55700.1 predicted protein
           [Physcomitrella patens] EDQ59322.1 histone H4
           [Physcomitrella patens] EDQ61622.1 histone H4
           [Physcomitrella patens] EDQ64125.1 histone H4
           [Physcomitrella patens] EDQ65492.1 histone H4
           [Physcomitrella patens] EDQ67076.1 histone H4
           [Physcomitrella patens] EDQ68981.1 histone H4
           [Physcomitrella patens] EDQ83164.1 histone H4
           [Physcomitrella patens] ACF80052.1 unknown [Zea mays]
           ACF80828.1 unknown [Zea mays] ACF82225.1 unknown [Zea
           mays] ACF82288.1 unknown [Zea mays] ACF83229.1 unknown
           [Zea mays] ACF83575.1 unknown [Zea mays] ACF83765.1
           unknown [Zea mays] ACF84258.1 unknown [Zea mays]
           ACF86280.1 unknown [Zea mays] ACF87214.1 unknown [Zea
           mays] ACF88257.1 unknown [Zea mays] ACG24613.1 histone
           H4 [Zea mays] ACG24646.1 histone H4 [Zea mays]
           ACG24650.1 histone H4 [Zea mays] ACG24821.1 histone H4
           [Zea mays] ACG25074.1 histone H4 [Zea mays] ACG25156.1
           histone H4 [Zea mays] ACG25337.1 histone H4 [Zea mays]
           ACG25500.1 histone H4 [Zea mays] ACG30422.1 histone H4
           [Zea mays] ACG30452.1 histone H4 [Zea mays] ACG30684.1
           histone H4 [Zea mays] ACG30745.1 histone H4 [Zea mays]
           ACG30750.1 histone H4 [Zea mays] ACG30751.1 histone H4
           [Zea mays] ACG30770.1 histone H4 [Zea mays] ACG30834.1
           histone H4 [Zea mays] ACG30836.1 histone H4 [Zea mays]
           ACG30868.1 histone H4 [Zea mays] ACG30869.1 histone H4
           [Zea mays] ACG30873.1 histone H4 [Zea mays] ACG30917.1
           histone H4 [Zea mays] ACG30996.1 histone H4 [Zea mays]
           ACG31045.1 histone H4 [Zea mays] ACG31057.1 histone H4
           [Zea mays] ACG31229.1 histone H4 [Zea mays] ACG31230.1
           histone H4 [Zea mays] ACG31234.1 histone H4 [Zea mays]
           ACG31300.1 histone H4 [Zea mays] ACG31315.1 histone H4
           [Zea mays] ACG31919.1 histone H4 [Zea mays] ACG32609.1
           histone H4 [Zea mays] ACG33427.1 histone H4 [Zea mays]
           ACG34413.1 histone H4 [Zea mays] ACG34866.1 histone H4
           [Zea mays] ACG35951.1 histone H4 [Zea mays] ACG35976.1
           histone H4 [Zea mays] ACG36015.1 histone H4 [Zea mays]
           ACG36304.1 histone H4 [Zea mays] ACG36622.1 histone H4
           [Zea mays] ACG37000.1 histone H4 [Zea mays] ACG37250.1
           histone H4 [Zea mays] ACG37605.1 histone H4 [Zea mays]
           ACG37825.1 histone H4 [Zea mays] ACG38812.1 histone H4
           [Zea mays] ACG39221.1 histone H4 [Zea mays] ACG48479.1
           histone H4 [Zea mays] ACG48490.1 histone H4 [Zea mays]
           ACG48509.1 histone H4 [Zea mays] ACG48644.1 histone H4
           [Zea mays] ACG48693.1 histone H4 [Zea mays] ACG49121.1
           histone H4 [Zea mays] BAG97383.1 unnamed protein product
           [Oryza sativa Japonica Group] BAG86775.1 unnamed protein
           product [Oryza sativa Japonica Group] BAG86791.1 unnamed
           protein product [Oryza sativa Japonica Group] BAG86871.1
           unnamed protein product [Oryza sativa Japonica Group]
           BAG86892.1 unnamed protein product [Oryza sativa
           Japonica Group] BAG99598.1 unnamed protein product
           [Oryza sativa Japonica Group] BAG99753.1 unnamed protein
           product [Oryza sativa Japonica Group] BAH19766.1
           AT1G07820 [Arabidopsis thaliana] EEE64000.1 hypothetical
           protein OsJ_18829 [Oryza sativa Japonica Group]
           EEE69764.1 hypothetical protein OsJ_29473 [Oryza sativa
           Japonica Group] EEE88496.1 histone H4 family protein
           [Populus trichocarpa] EEE91303.1 histone H4 family
           protein [Populus trichocarpa] EEE91305.1 hypothetical
           protein POPTR_0007s14020g [Populus trichocarpa]
           EEE91309.1 histone H4 family protein [Populus
           trichocarpa] EEF02497.1 hypothetical protein
           POPTR_0010s22090g [Populus trichocarpa] EEF03037.1
           histone H4 family protein [Populus trichocarpa]
           EEF03039.1 histone H4 family protein [Populus
           trichocarpa] EEF03621.1 hypothetical protein
           POPTR_0018s10040g [Populus trichocarpa] EEF29565.1
           histone h4, putative [Ricinus communis] EEF30724.1
           histone h4, putative [Ricinus communis] EEF30726.1
           histone h4, putative [Ricinus communis] EEF37320.1
           histone h4, putative [Ricinus communis] EEF43473.1
           histone h4, putative [Ricinus communis] EEF51073.1
           histone h4, putative [Ricinus communis] ACN35499.1
           unknown [Zea mays] ACN40254.1 unknown [Picea sitchensis]
           ACR36979.1 unknown [Zea mays] ACR37190.1 unknown [Zea
           mays] ACR38106.1 unknown [Zea mays] ACR38167.1 unknown
           [Zea mays] ACR38202.1 unknown [Zea mays] ACR38482.1
           unknown [Zea mays] EER95622.1 hypothetical protein
           SORBI_001G313200 [Sorghum bicolor] EER96771.1
           hypothetical protein SORBI_002G291100 [Sorghum bicolor]
           EER99324.1 hypothetical protein SORBI_002G210500
           [Sorghum bicolor] EES00250.1 hypothetical protein
           SORBI_003G056600 [Sorghum bicolor] EES00251.1
           hypothetical protein SORBI_003G057400 [Sorghum bicolor]
           EES01716.1 hypothetical protein SORBI_003G347900
           [Sorghum bicolor] EES02406.1 hypothetical protein
           SORBI_003G057100 [Sorghum bicolor] EES12723.1
           hypothetical protein SORBI_006G191800 [Sorghum bicolor]
           EES18362.1 hypothetical protein SORBI_009G167500
           [Sorghum bicolor] ACU13340.1 unknown [Glycine max]
           BAF06643.2 Os01g0835900 [Oryza sativa Japonica Group]
           BAH93978.1 Os07g0549900 [Oryza sativa Japonica Group]
           EFH40906.1 hypothetical protein ARALYDRAFT_496101
           [Arabidopsis lyrata subsp. lyrata] EFH52016.1
           hypothetical protein ARALYDRAFT_484971 [Arabidopsis
           lyrata subsp. lyrata] EFH53740.1 hypothetical protein
           ARALYDRAFT_485010 [Arabidopsis lyrata subsp. lyrata]
           EFH54197.1 hypothetical protein ARALYDRAFT_485763
           [Arabidopsis lyrata subsp. lyrata] EFH57265.1
           hypothetical protein ARALYDRAFT_481787 [Arabidopsis
           lyrata subsp. lyrata] BAJ89933.1 predicted protein
           [Hordeum vulgare subsp. vulgare] BAK01803.1 predicted
           protein [Hordeum vulgare subsp. vulgare] BAJ94137.1
           predicted protein [Hordeum vulgare subsp. vulgare]
           BAK02226.1 predicted protein [Hordeum vulgare subsp.
           vulgare] BAJ98718.1 predicted protein [Hordeum vulgare
           subsp. vulgare] BAK06265.1 predicted protein [Hordeum
           vulgare subsp. vulgare] BAK02764.1 predicted protein
           [Hordeum vulgare subsp. vulgare] BAJ91174.1 predicted
           protein [Hordeum vulgare subsp. vulgare] BAJ91200.1
           predicted protein [Hordeum vulgare subsp. vulgare]
           BAJ86564.1 predicted protein [Hordeum vulgare subsp.
           vulgare] BAJ86578.1 predicted protein [Hordeum vulgare
           subsp. vulgare] BAK04181.1 predicted protein [Hordeum
           vulgare subsp. vulgare] BAJ88750.1 predicted protein
           [Hordeum vulgare subsp. vulgare] BAK04343.1 predicted
           protein [Hordeum vulgare subsp. vulgare] BAK04649.1
           predicted protein [Hordeum vulgare subsp. vulgare]
           BAK08280.1 predicted protein [Hordeum vulgare subsp.
           vulgare] BAK05058.1 predicted protein [Hordeum vulgare
           subsp. vulgare] BAK05158.1 predicted protein [Hordeum
           vulgare subsp. vulgare] BAJ93645.1 predicted protein
           [Hordeum vulgare subsp. vulgare] AEC08165.1 histone H4
           [Arabidopsis thaliana] AEC10949.1 histone H4 [Camellia
           sinensis] AED97220.1 Histone superfamily protein
           [Arabidopsis thaliana] AED97260.1 Histone superfamily
           protein [Arabidopsis thaliana] AEE28158.1 Histone
           superfamily protein [Arabidopsis thaliana] AEE28187.1
           Histone superfamily protein [Arabidopsis thaliana]
           AEE28188.1 Histone superfamily protein [Arabidopsis
           thaliana] AEE78091.1 Histone superfamily protein
           [Arabidopsis thaliana] AEE78146.1 Histone superfamily
           protein [Arabidopsis thaliana] AEE79133.1 Histone
           superfamily protein [Arabidopsis thaliana] BAK64064.1
           histone H4 [Physcomitrella patens] AES67553.1 histone H4
           domain protein [Medicago truncatula] AES70711.1 histone
           H4 domain protein [Medicago truncatula] AES71173.1
           histone H4 domain protein [Medicago truncatula]
           AES81699.1 histone H4 domain protein [Medicago
           truncatula] AES88763.1 histone H4 domain protein
           [Medicago truncatula] AES98050.1 histone H4 domain
           protein [Medicago truncatula] AET02278.1 histone H4
           domain protein [Medicago truncatula] AEW08074.1
           hypothetical protein 0_18315_01 [Pinus radiata]
           AFG63669.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63670.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63671.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63672.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63673.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63674.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63675.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63676.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63677.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63678.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63679.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63680.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63681.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63682.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63683.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63684.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFG63685.1 hypothetical protein 0_18315_01 [Pinus taeda]
           AFK36911.1 unknown [Lotus japonicus] AFK40229.1 unknown
           [Medicago truncatula] AFK40827.1 unknown [Medicago
           truncatula] AFK42163.1 unknown [Lotus japonicus]
           AFK43817.1 unknown [Lotus japonicus] AFK47341.1 unknown
           [Medicago truncatula] CCI55324.1 PH01B001I13.20
           [Phyllostachys edulis] EMS51036.1 Histone H4 [Triticum
           urartu] EMS54800.1 Histone H4 [Triticum urartu]
           EMS57442.1 Histone H4 [Triticum urartu] EMS58789.1
           Histone H4 [Triticum urartu] EMS59432.1 Histone H4
           [Triticum urartu] EMS61471.1 Histone H4 [Triticum
           urartu] EMS63901.1 Histone H4 [Triticum urartu]
           EMS64239.1 Histone H4 [Triticum urartu] EMS66687.1
           Histone H4 [Triticum urartu] EMS67260.1 Histone H4
           [Triticum urartu] EMT05081.1 Histone H4 [Aegilops
           tauschii] EMT05082.1 Histone H4 [Aegilops tauschii]
           EMT09198.1 Histone H4 [Aegilops tauschii] EMT11852.1
           Histone H4 [Aegilops tauschii] EMT14600.1 Histone H4
           [Aegilops tauschii] EMT25001.1 Histone H4 [Aegilops
           tauschii] EMT29099.1 Histone H4 [Aegilops tauschii]
           EMT29315.1 Histone H4 [Aegilops tauschii] EMT29698.1
           Histone H4 [Aegilops tauschii] EMT31166.1 Histone H4
           [Aegilops tauschii] EMT33034.1 Histone H4 [Aegilops
           tauschii] EOA12403.1 hypothetical protein
           CARUB_v10027423mg [Capsella rubella] EOA24996.1
           hypothetical protein CARUB_v10018293mg [Capsella
           rubella] EOA24997.1 hypothetical protein
           CARUB_v10018294mg [Capsella rubella] EOA28192.1
           hypothetical protein CARUB_v10024384mg [Capsella
           rubella] EOA36353.1 hypothetical protein
           CARUB_v10010716mg [Capsella rubella] EOA36355.1
           hypothetical protein CARUB_v10010719mg [Capsella
           rubella] EOY07569.1 Histone superfamily protein isoform
           1 [Theobroma cacao] EOY07571.1 Histone superfamily
           protein [Theobroma cacao] EOY18195.1 Histone superfamily
           protein [Theobroma cacao] EOY27447.1 Histone superfamily
           protein [Theobroma cacao] EOY31835.1 Histone superfamily
           protein [Theobroma cacao] EOY34102.1 Histone superfamily
           protein [Theobroma cacao] EOY34196.1 Histone superfamily
           protein [Theobroma cacao] EPS60847.1 hypothetical
           protein M569_13955 [Genlisea aurea] EPS69507.1
           hypothetical protein M569_05259 [Genlisea aurea]
           EPS69742.1 hypothetical protein M569_05024 [Genlisea
           aurea] EPS72649.1 hypothetical protein M569_02106
           [Genlisea aurea] ERM96612.1 hypothetical protein
           AMTR_s00001p00271490 [Amborella trichopoda] ERN03265.1
           hypothetical protein AMTR_s00003p00201000 [Amborella
           trichopoda] ERN03394.1 hypothetical protein
           AMTR_s00003p00256370 [Amborella trichopoda] ERN05340.1
           hypothetical protein AMTR_s00007p00186150 [Amborella
           trichopoda] ERN07308.1 hypothetical protein
           AMTR_s00019p00220160 [Amborella trichopoda] ERN07310.1
           hypothetical protein AMTR_s00019p00220720 [Amborella
           trichopoda] ERN07312.1 hypothetical protein
           AMTR_s00019p00221780 [Amborella trichopoda] ERN14802.1
           hypothetical protein AMTR_s00032p00078840 [Amborella
           trichopoda] ERN17625.1 hypothetical protein
           AMTR_s00059p00172830 [Amborella trichopoda] EEF02546.2
           hypothetical protein POPTR_0010s22080g [Populus
           trichocarpa] ERP59603.1 hypothetical protein
           POPTR_0006s18360g [Populus trichocarpa] ERP60916.1
           hypothetical protein POPTR_0005s11740g [Populus
           trichocarpa] ERP60919.1 histone H4 family protein
           [Populus trichocarpa] ESQ36115.1 hypothetical protein
           EUTSA_v10009172mg [Eutrema salsugineum] ESQ37356.1
           hypothetical protein EUTSA_v10002735mg [Eutrema
           salsugineum] ESQ37418.1 hypothetical protein
           EUTSA_v10002736mg [Eutrema salsugineum] ESQ42347.1
           hypothetical protein EUTSA_v10016102mg [Eutrema
           salsugineum] ESQ42381.1 hypothetical protein
           EUTSA_v10015098mg [Eutrema salsugineum] ESQ45113.1
           hypothetical protein EUTSA_v10010851mg [Eutrema
           salsugineum] ESQ51360.1 hypothetical protein
           EUTSA_v10017468mg [Eutrema salsugineum] ESQ52397.1
           hypothetical protein EUTSA_v10017467mg [Eutrema
           salsugineum] ESR37954.1 hypothetical protein
           CICLE_v10029643mg [Citrus clementina] ESR37955.1
           hypothetical protein CICLE_v10029643mg [Citrus
           clementina] ESR38023.1 hypothetical protein
           CICLE_v10029640mg [Citrus clementina] ESR42275.1
           hypothetical protein CICLE_v10013183mg [Citrus
           clementina] ESR66617.1 hypothetical protein
           CICLE_v10009994mg [Citrus clementina] ESW04131.1
           hypothetical protein PHAVU_011G069700g [Phaseolus
           vulgaris] ESW14230.1 hypothetical protein
           PHAVU_008G263800g [Phaseolus vulgaris] ESW18740.1
           hypothetical protein PHAVU_006G066300g [Phaseolus
           vulgaris] ESW18741.1 hypothetical protein
           PHAVU_006G066400g [Phaseolus vulgaris] ESW18742.1
           hypothetical protein PHAVU_006G066400g [Phaseolus
           vulgaris] ESW22258.1 hypothetical protein
           PHAVU_005G139600g [Phaseolus vulgaris] ESW26760.1
           hypothetical protein PHAVU_003G145900g [Phaseolus
           vulgaris] ESW34650.1 hypothetical protein
           PHAVU_001G169200g [Phaseolus vulgaris] EXB52247.1
           Histone H4 [Morus notabilis] EXB53247.1 Histone H4
           [Morus notabilis] EXC02146.1 Histone H4 [Morus
           notabilis] EYU18905.1 hypothetical protein
           MIMGU_mgv1a016881mg [Erythranthe guttata] EYU20074.1
           hypothetical protein MIMGU_mgv1a016888mg [Erythranthe
           guttata] EYU26577.1 hypothetical protein
           MIMGU_mgv1a023067mg [Erythranthe guttata] EYU26674.1
           hypothetical protein MIMGU_mgv1a016867mg [Erythranthe
           guttata] EYU27473.1 hypothetical protein
           MIMGU_mgv1a023717mg [Erythranthe guttata] EYU33728.1
           hypothetical protein MIMGU_mgv1a018239mg [Erythranthe
           guttata] EYU41706.1 hypothetical protein
           MIMGU_mgv1a016883mg [Erythranthe guttata] KCW49468.1
           hypothetical protein EUGRSUZ_K02990 [Eucalyptus grandis]
           KCW49627.1 hypothetical protein EUGRSUZ_K03149
           [Eucalyptus grandis] KCW51668.1 hypothetical protein
           EUGRSUZ_J01149 [Eucalyptus grandis] KCW72615.1
           hypothetical protein EUGRSUZ_E01075 [Eucalyptus grandis]
           KCW77293.1 hypothetical protein EUGRSUZ_D01652
           [Eucalyptus grandis] KCW88114.1 hypothetical protein
           EUGRSUZ_A00511 [Eucalyptus grandis] KDO43694.1
           hypothetical protein CISIN_1g034139mg [Citrus sinensis]
           KDO46501.1 hypothetical protein CISIN_1g034144mg [Citrus
           sinensis] KDO72916.1 hypothetical protein
           CISIN_1g034133mg [Citrus sinensis] KDO73017.1
           hypothetical protein CISIN_1g034148mg [Citrus sinensis]
           KDP25531.1 hypothetical protein JCGZ_20687 [Jatropha
           curcas] KDP25545.1 hypothetical protein JCGZ_20701
           [Jatropha curcas] KDP36400.1 hypothetical protein
           JCGZ_08669 [Jatropha curcas] KDP44211.1 hypothetical
           protein JCGZ_05678 [Jatropha curcas] KEH22067.1 histone
           H4 domain protein [Medicago truncatula] KEH30080.1
           histone H4 domain protein [Medicago truncatula]
           KEH33936.1 histone H4 domain protein [Medicago
           truncatula] KEH34158.1 histone H4 domain protein
           [Medicago truncatula] KEH34159.1 histone H4 domain
           protein [Medicago truncatula] KEH34165.1 histone H4
           domain protein [Medicago truncatula] KEH34182.1 histone
           H4 domain protein [Medicago truncatula] CDP08969.1
           unnamed protein product [Coffea canephora] CDP09020.1
           unnamed protein product [Coffea canephora] CDP06635.1
           unnamed protein product [Coffea canephora] CDP00010.1
           unnamed protein product [Coffea canephora] CDP00068.1
           unnamed protein product [Coffea canephora] CDM82261.1
           unnamed protein product [Triticum aestivum] CDM84803.1
           unnamed protein product [Triticum aestivum] KFK27507.1
           hypothetical protein AALP_AA8G392100 [Arabis alpina]
           KFK27535.1 hypothetical protein AALP_AA8G395900 [Arabis
           alpina] KFK33956.1 histone h4 [Arabis alpina] KFK33958.1
           hypothetical protein AALP_AA5G083900 [Arabis alpina]
           KFK34624.1 hypothetical protein AALP_AA5G170000 [Arabis
           alpina] KFK36645.1 hypothetical protein AALP_AA4G151600
           [Arabis alpina] KFK43086.1 hypothetical protein
           AALP_AA1G077500 [Arabis alpina] CDY70247.1 BnaCnng67420D
           [Brassica napus] CDY60565.1 BnaA02g06910D [Brassica
           napus] CDY58832.1 BnaAnng15490D [Brassica napus]
           CDY56098.1 BnaC02g44320D [Brassica napus] CDY32809.1
           BnaC08g02310D [Brassica napus] CDY31726.1 BnaA04g16620D
           [Brassica napus] CDY22719.1 BnaC08g43530D [Brassica
           napus] CDY18434.1 BnaA04g21530D [Brassica napus]
           CDY15777.1 BnaC04g15470D [Brassica napus] CDY07783.1
           BnaA03g17280D [Brassica napus] CDY06280.1 BnaA09g49230D
           [Brassica napus] CDY04583.1 BnaA07g14090D [Brassica
           napus] CDX99135.1 BnaA06g18260D [Brassica napus]
           CDX95760.1 BnaC03g26410D [Brassica napus] CDX95121.1
           BnaC05g05500D [Brassica napus] CDX93616.1 BnaA06g04320D
           [Brassica napus] CDX93630.1 BnaA06g04180D [Brassica
           napus] CDX88717.1 BnaA03g09320D [Brassica napus]
           CDX88290.1 BnaC06g37340D [Brassica napus] CDX86050.1
           BnaC03g55650D [Brassica napus] CDX83302.1 BnaA03g22040D
           [Brassica napus] CDX79740.1 BnaC03g20760D [Brassica
           napus] CDX78198.1 BnaA09g33930D [Brassica napus]
           CDX77204.1 BnaC04g39990D [Brassica napus] CDX74951.1
           BnaA05g06970D [Brassica napus] CDX71081.1 BnaC03g11650D
           [Brassica napus] KGN45824.1 Histone H4 [Cucumis sativus]
           KGN47169.1 Histone H4 [Cucumis sativus] KGN47170.1
           hypothetical protein Csa_6G191580 [Cucumis sativus]
           KGN47171.1 hypothetical protein Csa_6G192080 [Cucumis
           sativus] KGN47172.1 Histone H4 [Cucumis sativus]
           KGN47173.1 Histone H4 [Cucumis sativus] KGN64733.1
           hypothetical protein Csa_1G084320 [Cucumis sativus]
           AIZ04727.1 histone 4 [Elettaria cardamomum] AIZ04728.1
           histone 4 [Nicotiana benthamiana] KHN05358.1 Histone H4
           [Glycine soja] KHN05694.1 Histone H4 [Glycine soja]
           KHN06242.1 Histone H4 [Glycine soja] KHN09422.1 Histone
           H4 [Glycine soja] KHN12566.1 Histone H4 [Glycine soja]
           KHN12567.1 Histone H4 [Glycine soja] KHN12568.1 Histone
           H4 [Glycine soja] KHN22012.1 Histone H4 [Glycine soja]
           KHN33428.1 Histone H4 [Glycine soja] KHN40041.1 Histone
           H4 [Glycine soja] KHN41537.1 Histone H4 [Glycine soja]
           KHN48230.1 Histone H4 [Glycine soja] BAQ19379.1 histone
           H4 [Sarracenia purpurea] KJB16932.1 hypothetical protein
           B456_002G255200 [Gossypium raimondii] KJB20200.1
           hypothetical protein B456_003G138000 [Gossypium
           raimondii] KJB21608.1 hypothetical protein
           B456_004G002700 [Gossypium raimondii] KJB21611.1
           hypothetical protein B456_004G003000 [Gossypium
           raimondii] KJB21620.1 hypothetical protein
           B456_004G004600 [Gossypium raimondii] KJB21641.1
           hypothetical protein B456_004G005900 [Gossypium
           raimondii] KJB55990.1 hypothetical protein
           B456_009G102900 [Gossypium raimondii] KJB70009.1
           hypothetical protein B456_011G053000 [Gossypium
           raimondii] KJB76718.1 hypothetical protein
           B456_012G102800 [Gossypium raimondii] KJB83811.1
           hypothetical protein B456_013G265800 [Gossypium
           raimondii] KMS97567.1 hypothetical protein BVRB_5g125910
           [Beta vulgaris subsp. vulgaris] KMS97568.1 hypothetical
           protein BVRB_5g125920 [Beta vulgaris subsp. vulgaris]
           KMS97569.1 hypothetical protein BVRB_5g125930 [Beta
           vulgaris subsp. vulgaris] KMS98764.1 hypothetical
           protein BVRB_3g068420 [Beta vulgaris subsp. vulgaris]
           KMT05290.1 hypothetical protein BVRB_7g174280 [Beta
           vulgaris subsp. vulgaris] KMT15427.1 hypothetical
           protein BVRB_3g061320 [Beta vulgaris subsp. vulgaris]
           KMT19540.1 hypothetical protein BVRB_1g011610 [Beta
           vulgaris subsp. vulgaris] KNA13214.1 hypothetical
           protein SOVF_118800 [Spinacia oleracea] KNA14759.1
           hypothetical protein SOVF_104740 [Spinacia oleracea]
           KNA15746.1 hypothetical protein SOVF_095450 [Spinacia
           oleracea] KNA15747.1 hypothetical protein SOVF_095460
           [Spinacia oleracea] KNA15748.1 hypothetical protein
           SOVF_095470 [Spinacia oleracea] KNA15766.1 hypothetical
           protein SOVF_095210 [Spinacia oleracea] KNA19789.1
           hypothetical protein SOVF_058290 [Spinacia oleracea]
           KNA22027.1 hypothetical protein SOVF_037970 [Spinacia
           oleracea] KNA26079.1 hypothetical protein SOVF_000690
           [Spinacia oleracea] KOM26701.1 hypothetical protein
           LR48_Vigan306s000300 [Vigna angularis] KOM29001.1
           hypothetical protein LR48_Vigan627s005000 [Vigna
           angularis] KOM29891.1 hypothetical protein
           LR48_Vigan831s000900 [Vigna angularis] KOM44246.1
           hypothetical protein LR48_Vigan05g185100 [Vigna
           angularis] KOM49405.1 hypothetical protein
           LR48_Vigan08g023200 [Vigna angularis] KOM49594.1
           hypothetical protein LR48_Vigan08g042100 [Vigna
           angularis] KOM50760.1 hypothetical protein
           LR48_Vigan08g158700 [Vigna angularis] KOM52573.1
           hypothetical protein LR48_Vigan09g123200 [Vigna
           angularis] KOM52574.1 hypothetical protein
           LR48_Vigan09g123300 [Vigna angularis] BAS75107.1
           Os01g0835900 [Oryza sativa Japonica Group] BAS80323.1
           Os02g0684500 [Oryza sativa Japonica Group] BAS82016.1
           Os03g0119900 [Oryza sativa Japonica Group] BAS90673.1
           Os04g0583600 [Oryza sativa Japonica Group] BAS94424.1
           Os05g0462700 [Oryza sativa Japonica Group] BAS94452.1
           Os05g0466600 [Oryza sativa Japonica Group] BAT02038.1
           Os07g0549900 [Oryza sativa Japonica Group] BAT08228.1
           Os09g0433600 [Oryza sativa Japonica Group] BAT09322.1
           Os09g0553100 [Oryza sativa Japonica Group] BAT11849.1
           Os10g0539500 [Oryza sativa Japonica Group] KQJ84202.1
           hypothetical protein BRADI_5g19350 [Brachypodium
           distachyon] KQJ86516.1 hypothetical protein
           BRADI_4g06040 [Brachypodium distachyon] KQJ90348.1
           hypothetical protein BRADI_4g30960 [Brachypodium
           distachyon] KQK05829.1 hypothetical protein
           BRADI_2g22790 [Brachypodium distachyon] KQK05860.1
           hypothetical protein BRADI_2g22990 [Brachypodium
           distachyon] KQK12788.1 hypothetical protein
           BRADI_1g05980 [Brachypodium distachyon] KQK22583.1
           hypothetical protein BRADI_1g68190 [Brachypodium
           distachyon] KQK92904.1 hypothetical protein
           SETIT_038166mg [Setaria italica] KQK98617.1 hypothetical
           protein SETIT_011423mg [Setaria italica] KQL01545.1
           hypothetical protein SETIT_014712mg [Setaria italica]
           KQL07618.1 hypothetical protein SETIT_003454mg [Setaria
           italica] KQL15110.1 hypothetical protein SETIT_023745mg
           [Setaria italica] KQL24594.1 hypothetical protein
           SETIT_031602mg [Setaria italica] KQL30971.1 hypothetical
           protein SETIT_018796mg [Setaria italica] KRG88688.1
           hypothetical protein GLYMA_U033600 [Glycine max]
           KRG90333.1 hypothetical protein GLYMA_20G083800 [Glycine
           max] KRG98308.1 hypothetical protein GLYMA_18G064300
           [Glycine max] KRH02870.1 hypothetical protein
           GLYMA_17G063200 [Glycine max] KRH10344.1 hypothetical
           protein GLYMA_15G043200 [Glycine max] KRH10345.1
           hypothetical protein GLYMA_15G043200 [Glycine max]
           KRH16996.1 hypothetical protein GLYMA_14G190800 [Glycine
           max] KRH19969.1 hypothetical protein GLYMA_13G147000
           [Glycine max] KRH24981.1 hypothetical protein
           GLYMA_12G074500 [Glycine max] KRH30344.1 hypothetical
           protein GLYMA_11G177800 [Glycine max] KRH30345.1
           hypothetical protein GLYMA_11G177900 [Glycine max]
           KRH30347.1 hypothetical protein GLYMA_11G178100 [Glycine
           max] KRH30348.1 hypothetical protein GLYMA_11G178200
           [Glycine max] KRH33582.1 hypothetical protein
           GLYMA_10G133500 [Glycine max] KRH67535.1 hypothetical
           protein GLYMA_03G171400 [Glycine max] KRH72633.1
           hypothetical protein GLYMA_02G224100 [Glycine max]
           BAT88364.1 hypothetical protein VIGAN_05183800 [Vigna
           angularis var. angularis] BAT88365.1 hypothetical
           protein VIGAN_05183900 [Vigna angularis var. angularis]
           BAT89488.1 hypothetical protein VIGAN_06045200 [Vigna
           angularis var. angularis] BAT89583.1 hypothetical
           protein VIGAN_06057000 [Vigna angularis var. angularis]
           BAT90665.1 hypothetical protein VIGAN_06194200 [Vigna
           angularis var. angularis] BAT91914.1 hypothetical
           protein VIGAN_07055700 [Vigna angularis var. angularis]
           BAT74750.1 hypothetical protein VIGAN_01249700 [Vigna
           angularis var. angularis] BAT76735.1 hypothetical
           protein VIGAN_01478500 [Vigna angularis var. angularis]
           BAT85623.1 hypothetical protein VIGAN_04319000 [Vigna
           angularis var. angularis] CUT18458.1 H4 [Lilium davidii
           var. unicolor] KVG36273.1 Histone core [Cynara
           cardunculus var. scolymus] KVG36274.1 hypothetical
           protein Ccrd_026469 [Cynara cardunculus var. scolymus]
           KVH88470.1 Histone core [Cynara cardunculus var.
           scolymus] KVI03176.1 hypothetical protein Ccrd_018530
           [Cynara cardunculus var. scolymus] KVI03592.1 Histone
           core [Cynara cardunculus var. scolymus] KVI07817.1
           Histone core [Cynara cardunculus var. scolymus]
           KVI11998.1 Histone core [Cynara cardunculus var.
           scolymus] KYP33406.1 Histone H4 [Cajanus cajan]
           KYP42925.1 Histone H4 [Cajanus cajan] KYP45343.1 Histone
           H4 [Cajanus cajan] KYP57463.1 Histone H4 [Cajanus cajan]
           KYP58596.1 Histone H4 [Cajanus cajan] KYP68442.1 Histone
           H4 [Cajanus cajan] KYP76122.1 Histone H4 [Cajanus cajan]
           KYP76125.1 Histone H4 [Cajanus cajan] KYP76127.1 Histone
           H4 [Cajanus cajan] KZM94638.1 hypothetical protein
           DCAR_017881 [Daucus carota subsp. sativus] KZM95623.1
           hypothetical protein DCAR_018865 [Daucus carota subsp.
           sativus] KZM95654.1 hypothetical protein DCAR_018896
           [Daucus carota subsp. sativus] KZM97937.1 hypothetical
           protein DCAR_014701 [Daucus carota subsp. sativus]
           KZN05148.1 hypothetical protein DCAR_005985 [Daucus
           carota subsp. sativus] KZN05153.1 hypothetical protein
           DCAR_005990 [Daucus carota subsp. sativus] KZN05156.1
           hypothetical protein DCAR_005993 [Daucus carota subsp.
           sativus] KZN05158.1 hypothetical protein DCAR_005995
           [Daucus carota subsp. sativus] KZV19615.1 hypothetical
           protein F511_10518 [Dorcoceras hygrometricum] KZV23426.1
           hypothetical protein F511_43338 [Dorcoceras
           hygrometricum] KZV33126.1 hypothetical protein
           F511_03392 [Dorcoceras hygrometricum] KZV35045.1
           hypothetical protein F511_04350 [Dorcoceras
           hygrometricum] KZV51788.1 hypothetical protein
           F511_11476 [Dorcoceras hygrometricum] OAO92471.1
           hypothetical protein AXX17_AT5G59110 [Arabidopsis
           thaliana] OAO95258.1 hypothetical protein
           AXX17_AT5G59410 [Arabidopsis thaliana] OAP04740.1
           hypothetical protein AXX17_AT3G40210 [Arabidopsis
           thaliana] OAP04980.1 hypothetical protein
           AXX17_AT3G48100 [Arabidopsis thaliana] OAP08079.1
           hypothetical protein AXX17_AT2G24850 [Arabidopsis
           thaliana] OAP15907.1 hypothetical protein
           AXX17_AT1G07520 [Arabidopsis thaliana] OAP16019.1
           hypothetical protein AXX17_AT1G07310 [Arabidopsis
           thaliana] OAY31148.1 hypothetical protein
           MANES_14G087900 [Manihot esculenta] OAY37892.1
           hypothetical protein MANES_11G137100 [Manihot esculenta]
           OAY38731.1 hypothetical protein MANES_10G039100 [Manihot
           esculenta] OAY46073.1 hypothetical protein
           MANES_07G114600 [Manihot esculenta] OAY47472.1
           hypothetical protein MANES_06G082200 [Manihot esculenta]
           OAY51739.1 hypothetical protein MANES_04G028700 [Manihot
           esculenta] OAY51785.1 hypothetical protein
           MANES_04G032600 [Manihot esculenta] OAY56602.1
           hypothetical protein MANES_02G030600 [Manihot esculenta]
           OAY59902.1 hypothetical protein MANES_01G069400 [Manihot
           esculenta] OAY62981.1 Histone H4 [Ananas comosus]
           OAY66164.1 Histone H4 [Ananas comosus] OAY72693.1
           Histone H4 [Ananas comosus] OAY79827.1 Histone H4
           [Ananas comosus] OAY84103.1 Histone H4 [Ananas comosus]
           ANM70482.1 Histone superfamily protein [Arabidopsis
           thaliana] OEL16490.1 Histone H4 [Dichanthelium
           oligosanthes] OEL20720.1 Histone H4 [Dichanthelium
           oligosanthes] OEL23212.1 Histone H4 [Dichanthelium
           oligosanthes] OEL24175.1 Histone H4 [Dichanthelium
           oligosanthes] OEL32106.1 Histone H4 [Dichanthelium
           oligosanthes] OEL36021.1 Histone H4 [Dichanthelium
           oligosanthes] JAU05429.1 Histone H4 [Noccaea
           caerulescens] JAU19915.1 Histone H4 [Noccaea
           caerulescens] JAU28517.1 Histone H4 [Noccaea
           caerulescens] JAU66211.1 Histone H4 [Noccaea
           caerulescens] JAU73443.1 Histone H4 [Noccaea
           caerulescens] JAU97318.1 Histone H4 [Noccaea
           caerulescens] OIS95648.1 histone h4 [Nicotiana
           attenuata] OIS95649.1 histone h4 [Nicotiana attenuata]
           OIT22436.1 histone h4 [Nicotiana attenuata] OIT28377.1
           histone h4 [Nicotiana attenuata] OIT29232.1 histone h4
           [Nicotiana attenuata] OIT30437.1 histone h4 [Nicotiana
           attenuata] OIT33558.1 histone h4 [Nicotiana attenuata]
           OIT33559.1 histone h4 [Nicotiana attenuata] OIT34992.1
           histone h4 [Nicotiana attenuata] OIT37424.1 histone h4
           [Nicotiana attenuata] OIT40759.1 histone h4 [Nicotiana
           attenuata] OIV90495.1 hypothetical protein TanjilG_10259
           [Lupinus angustifolius] OIV92124.1 hypothetical protein
           TanjilG_26982 [Lupinus angustifolius] OIV97187.1
           hypothetical protein TanjilG_28938 [Lupinus
           angustifolius] OIV97188.1 hypothetical protein
           TanjilG_28939 [Lupinus angustifolius] OIV99794.1
           hypothetical protein TanjilG_26132 [Lupinus
           angustifolius] OIW01639.1 hypothetical protein
           TanjilG_18210 [Lupinus angustifolius] OIW03951.1
           hypothetical protein TanjilG_30227 [Lupinus
           angustifolius] OIW04349.1 hypothetical protein
           TanjilG_32541 [Lupinus angustifolius] OIW06108.1
           hypothetical protein TanjilG_29864 [Lupinus
           angustifolius] OIW08598.1 hypothetical protein
           TanjilG_03274 [Lupinus angustifolius] OIW08600.1
           hypothetical protein TanjilG_03276 [Lupinus
           angustifolius] OIW11232.1 hypothetical protein
           TanjilG_28323 [Lupinus angustifolius] OIW13234.1
           hypothetical protein TanjilG_02368 [Lupinus
           angustifolius] OIW18679.1 hypothetical protein
           TanjilG_13431 [Lupinus angustifolius] APR64201.1 histone
           H4 family protein [Populus tomentosa] GAV71402.1 Histone
           domain-containing protein [Cephalotus follicularis]
           OMO58938.1 Histone H4 [Corchorus capsularis] OMO66237.1
           Histone H4 [Corchorus capsularis] OMO67623.1 Histone H4
           [Corchorus capsularis] OMO67706.1 Histone H4 [Corchorus
           capsularis] OMO69468.1 Histone H4 [Corchorus capsularis]
           OMO69469.1 Histone H4 [Corchorus capsularis] OMO91301.1
           Histone H4 [Corchorus olitorius] OMO91388.1 Histone H4
           [Corchorus olitorius] OMO96940.1 Histone H4 [Corchorus
           olitorius] OMO97179.1 Histone H4 [Corchorus olitorius]
           OMP09108.1 Histone H4 [Corchorus olitorius] ONH94763.1
           hypothetical protein PRUPE_7G028400 [Prunus persica]
           ONI00305.1 hypothetical protein PRUPE_6G081300 [Prunus
           persica] ONI03336.1 hypothetical protein PRUPE_6G251900
           [Prunus persica] ONI07661.1 hypothetical protein
           PRUPE_5G134000 [Prunus persica] ONI24277.1 hypothetical
           protein PRUPE_2G232000 [Prunus persica] ONI24279.1
           hypothetical protein PRUPE_2G232200 [Prunus persica]
           ONL93034.1 Histone H4 [Zea mays] AQK45299.1 Histone H4
           [Zea mays] ONM14629.1 Histone H4 [Zea mays] ONM14650.1
           Histone H4 [Zea mays] ONM22111.1 Histone H4 [Zea mays]
           ONM29854.1 Histone H4 [Zea mays] ONM36601.1 Histone H4
           [Zea mays] AQK54299.1 Histone H4 [Zea mays] AQK90411.1
           Histone H4 [Zea mays] AQK94391.1 Histone H4 [Zea mays]
           AQK99537.1 Histone H4 [Zea mays] ONM55158.1 Histone H4
           [Zea mays] ONM55159.1 Histone H4 [Zea mays] ONM57249.1
           Histone H4 [Zea mays] prf||1314298A histone H4
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>XP_008371481.1 PREDICTED: histone H4 [Malus domestica] XP_008357955.1 PREDICTED:
           histone H4 [Malus domestica] XP_008369869.1 PREDICTED:
           histone H4 [Malus domestica] XP_008374142.1 PREDICTED:
           histone H4 [Malus domestica] XP_008392655.1 PREDICTED:
           histone H4 [Malus domestica] XP_008345826.1 PREDICTED:
           histone H4-like [Malus domestica] XP_008352072.1
           PREDICTED: histone H4-like [Malus domestica]
           XP_008366332.1 PREDICTED: histone H4 [Malus domestica]
           XP_008366723.1 PREDICTED: histone H4 [Malus domestica]
           XP_009353713.1 PREDICTED: histone H4-like [Pyrus x
           bretschneideri] XP_009357629.1 PREDICTED: histone
           H4-like [Pyrus x bretschneideri] XP_009357701.1
           PREDICTED: histone H4-like [Pyrus x bretschneideri]
           XP_009358291.1 PREDICTED: histone H4-like [Pyrus x
           bretschneideri] XP_009358344.1 PREDICTED: histone
           H4-like [Pyrus x bretschneideri] XP_009360213.1
           PREDICTED: histone H4-like [Pyrus x bretschneideri]
           XP_009374675.1 PREDICTED: histone H4-like [Pyrus x
           bretschneideri] XP_009379533.1 PREDICTED: histone
           H4-like [Pyrus x bretschneideri] XP_009335939.1
           PREDICTED: histone H4-like [Pyrus x bretschneideri]
           XP_009338767.1 PREDICTED: histone H4-like [Pyrus x
           bretschneideri] XP_009348695.1 PREDICTED: histone
           H4-like [Pyrus x bretschneideri] XP_009350738.1
           PREDICTED: histone H4-like [Pyrus x bretschneideri]
           ADL36649.1 C3HL domain class transcription factor [Malus
           domestica] ADL36654.1 C3HL domain class transcription
           factor [Malus domestica]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>AAT08725.1 histone H4 [Hyacinthus orientalis]
          Length = 103

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 8   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 67

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 68  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 99


>GAV63738.1 Histone domain-containing protein, partial [Cephalotus
           follicularis] GAV57897.1 Histone domain-containing
           protein, partial [Cephalotus follicularis]
          Length = 104

 Score =  182 bits (462), Expect = 1e-57
 Identities = 92/92 (100%), Positives = 92/92 (100%)
 Frame = -1

Query: 349 GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 170
           GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
Sbjct: 9   GKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 68

Query: 169 RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 74
           RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 69  RDAVTYTEHARRKTVTAMDVVYALKRQGRTLY 100


Top