BLASTX nr result
ID: Phellodendron21_contig00005878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00005878 (646 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006447155.1 hypothetical protein CICLE_v10017154mg [Citrus cl... 132 5e-37 AFK34152.1 unknown [Lotus japonicus] 129 5e-35 XP_016676291.1 PREDICTED: 39S ribosomal protein L54, mitochondri... 127 2e-34 XP_017647320.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 127 3e-34 OMO73604.1 Mitochondrial ribosomal protein [Corchorus capsularis] 127 4e-34 XP_017238247.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 127 6e-34 XP_019453035.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 126 8e-34 XP_007031752.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 126 1e-33 XP_016698527.1 PREDICTED: 39S ribosomal protein L54, mitochondri... 125 3e-33 JAU96910.1 hypothetical protein MP_TR2149_c0_g1_i1_g.6558, parti... 126 4e-33 XP_010271329.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 124 5e-33 KJB74600.1 hypothetical protein B456_012G089400 [Gossypium raimo... 124 6e-33 OMO69078.1 Ribosomal protein L37, mitochondrial [Corchorus olito... 124 7e-33 XP_012458700.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 124 7e-33 OAP01829.1 hypothetical protein AXX17_AT3G00870 [Arabidopsis tha... 124 8e-33 XP_019426663.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 124 9e-33 XP_014507403.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 124 1e-32 XP_012457195.1 PREDICTED: 39S ribosomal protein L54, mitochondri... 124 1e-32 XP_012458699.1 PREDICTED: 54S ribosomal protein L37, mitochondri... 124 1e-32 NP_566150.1 Mitochondrial ribosomal protein L37 [Arabidopsis tha... 123 1e-32 >XP_006447155.1 hypothetical protein CICLE_v10017154mg [Citrus clementina] XP_006447156.1 hypothetical protein CICLE_v10017154mg [Citrus clementina] XP_006469981.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Citrus sinensis] ESR60395.1 hypothetical protein CICLE_v10017154mg [Citrus clementina] ESR60396.1 hypothetical protein CICLE_v10017154mg [Citrus clementina] KDO41387.1 hypothetical protein CISIN_1g032859mg [Citrus sinensis] Length = 132 Score = 132 bits (332), Expect(2) = 5e-37 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILKEGSDPKVL DSEYPDWLWHLLEKRPALSEL+MKN+ETLPY LKRF KLDNR Sbjct: 60 VVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELKMKNIETLPYEDLKRFLKLDNR 119 Query: 437 ERI*ENNSIKAKN 475 +I ENNS+KAKN Sbjct: 120 AKIKENNSVKAKN 132 Score = 50.4 bits (119), Expect(2) = 5e-37 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 141 MAMNQIRSLRNFIMMKETVGKVGQRTF 221 MAMNQI SLR+FIM+KETVGKVGQRTF Sbjct: 1 MAMNQITSLRSFIMVKETVGKVGQRTF 27 >AFK34152.1 unknown [Lotus japonicus] Length = 131 Score = 129 bits (325), Expect = 5e-35 Identities = 61/73 (83%), Positives = 66/73 (90%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILKEGSDPK+L DSEYPDWLWHLL+KRPALSELR KN+ETL Y YLKR+ KLDNR Sbjct: 59 VVGANILKEGSDPKILPDSEYPDWLWHLLDKRPALSELRRKNIETLSYEYLKRYVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 119 ARIKENNSLKAKN 131 >XP_016676291.1 PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium hirsutum] Length = 111 Score = 127 bits (320), Expect = 2e-34 Identities = 60/73 (82%), Positives = 66/73 (90%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK++ DSEYPDWLWHLL+KRPALSELR KN+ETLPY LKRF KLDNR Sbjct: 39 VVGANILKDGTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNR 98 Query: 437 ERI*ENNSIKAKN 475 RI ENNSIKAKN Sbjct: 99 ARIKENNSIKAKN 111 >XP_017647320.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Gossypium arboreum] KHG03339.1 54S ribosomal L37, mitochondrial [Gossypium arboreum] Length = 131 Score = 127 bits (320), Expect = 3e-34 Identities = 60/73 (82%), Positives = 66/73 (90%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK++ DSEYPDWLWHLL+KRPALSELR KN+ETLPY LKRF KLDNR Sbjct: 59 VVGANILKDGTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 RI ENNSIKAKN Sbjct: 119 ARIKENNSIKAKN 131 >OMO73604.1 Mitochondrial ribosomal protein [Corchorus capsularis] Length = 130 Score = 127 bits (319), Expect = 4e-34 Identities = 60/73 (82%), Positives = 66/73 (90%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+L DSEYPDWLWHLL+KRPALSELR KNV+TLPY LKRF KLDNR Sbjct: 58 VVGANILKDGADPKILPDSEYPDWLWHLLDKRPALSELRRKNVDTLPYEDLKRFVKLDNR 117 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 118 ARIKENNSVKAKN 130 >XP_017238247.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Daucus carota subsp. sativus] KZN02542.1 hypothetical protein DCAR_011296 [Daucus carota subsp. sativus] Length = 131 Score = 127 bits (318), Expect = 6e-34 Identities = 61/73 (83%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILKEG DPKVL+DSEYPDWLWHLL+KRPALSELR K+ ETLPY LKRF KLDNR Sbjct: 59 VVGANILKEGGDPKVLADSEYPDWLWHLLDKRPALSELRRKSTETLPYDDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 119 ARIKENNSLKAKN 131 >XP_019453035.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Lupinus angustifolius] XP_019453036.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Lupinus angustifolius] XP_019453037.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Lupinus angustifolius] XP_019453038.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Lupinus angustifolius] OIW06439.1 hypothetical protein TanjilG_05210 [Lupinus angustifolius] Length = 130 Score = 126 bits (317), Expect = 8e-34 Identities = 60/73 (82%), Positives = 66/73 (90%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPKVL DSEYPDWLWHLL+KRPALSELR K++ETLPY LKRF KLDNR Sbjct: 58 VVGANILKDGTDPKVLPDSEYPDWLWHLLDKRPALSELRRKSIETLPYEDLKRFVKLDNR 117 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 118 ARIKENNSVKAKN 130 >XP_007031752.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] XP_007031754.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] XP_017974164.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] XP_017974165.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] EOY02676.1 Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] EOY02677.1 Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] EOY02678.1 Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] EOY02679.1 Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] EOY02680.1 Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] Length = 131 Score = 126 bits (316), Expect = 1e-33 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK++ DSEYPDWLWHLL+KRPALSELR KN+ETLPY LKRF KLDNR Sbjct: 59 VVGANILKDGADPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 RI ENN++KAKN Sbjct: 119 ARIKENNAVKAKN 131 >XP_016698527.1 PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium hirsutum] Length = 131 Score = 125 bits (313), Expect = 3e-33 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK++ DSEYPDWLWHLL+KRPALSELR KN+ETLPY LKRF KLDNR Sbjct: 59 VVGANILKDGTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 I ENNSIKAKN Sbjct: 119 ALIKENNSIKAKN 131 >JAU96910.1 hypothetical protein MP_TR2149_c0_g1_i1_g.6558, partial [Noccaea caerulescens] Length = 174 Score = 126 bits (316), Expect = 4e-33 Identities = 64/93 (68%), Positives = 73/93 (78%), Gaps = 2/93 (2%) Frame = +2 Query: 203 GGPTNICGWGW*SKE--GXXVVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRM 376 GGP++ SKE VVGAN LK+G+DPK+LSDS+YPDWLWHLL+KRPALSELR Sbjct: 82 GGPSDAPKGSSLSKEIKSTTVVGANTLKDGADPKILSDSDYPDWLWHLLDKRPALSELRR 141 Query: 377 KNVETLPYGYLKRFFKLDNRERI*ENNSIKAKN 475 KNVETLPY LKRF KLD R +I ENNS+KAKN Sbjct: 142 KNVETLPYDDLKRFVKLDTRAKIKENNSVKAKN 174 >XP_010271329.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nelumbo nucifera] Length = 132 Score = 124 bits (312), Expect = 5e-33 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+L DSEYPDWLWHLL+K+PALSELR KN+ETLPY LKRF KLDNR Sbjct: 60 VVGANILKDGADPKILPDSEYPDWLWHLLDKKPALSELRRKNIETLPYDELKRFVKLDNR 119 Query: 437 ERI*ENNSIKAKN 475 RI ENN I+AKN Sbjct: 120 ARIKENNVIRAKN 132 >KJB74600.1 hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 126 Score = 124 bits (311), Expect = 6e-33 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+ DSEYPDWLWHLL+KRPALSELR K++ETLPY LKRF KLDNR Sbjct: 54 VVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNR 113 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 114 ARIKENNSVKAKN 126 >OMO69078.1 Ribosomal protein L37, mitochondrial [Corchorus olitorius] Length = 130 Score = 124 bits (311), Expect = 7e-33 Identities = 57/73 (78%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+L DSEYPDWLWHLL+KRPALSELR KN++T PY LKRF KLDNR Sbjct: 58 VVGANILKDGADPKILPDSEYPDWLWHLLDKRPALSELRRKNIDTFPYEDLKRFVKLDNR 117 Query: 437 ERI*ENNSIKAKN 475 +I ENNS+KAKN Sbjct: 118 AKIKENNSVKAKN 130 >XP_012458700.1 PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Gossypium raimondii] KJB74598.1 hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 131 Score = 124 bits (311), Expect = 7e-33 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+ DSEYPDWLWHLL+KRPALSELR K++ETLPY LKRF KLDNR Sbjct: 59 VVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 119 ARIKENNSVKAKN 131 >OAP01829.1 hypothetical protein AXX17_AT3G00870 [Arabidopsis thaliana] Length = 126 Score = 124 bits (310), Expect = 8e-33 Identities = 59/73 (80%), Positives = 64/73 (87%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGAN LK+GSDPK+L DS+YPDWLWHLL+KRPALSELR KNVETLPY LKRF KLD R Sbjct: 54 VVGANTLKDGSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYDDLKRFVKLDTR 113 Query: 437 ERI*ENNSIKAKN 475 +I ENNSIKAKN Sbjct: 114 AKIKENNSIKAKN 126 >XP_019426663.1 PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Lupinus angustifolius] OIV90122.1 hypothetical protein TanjilG_01576 [Lupinus angustifolius] Length = 130 Score = 124 bits (310), Expect = 9e-33 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+L DSEYPDWLWHLL+KRPALSELR K++E LPY LKRF KLDNR Sbjct: 58 VVGANILKDGTDPKILLDSEYPDWLWHLLDKRPALSELRRKSIEALPYEDLKRFVKLDNR 117 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 118 ARIKENNSVKAKN 130 >XP_014507403.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Vigna radiata var. radiata] XP_014507404.1 PREDICTED: 54S ribosomal protein L37, mitochondrial [Vigna radiata var. radiata] Length = 131 Score = 124 bits (310), Expect = 1e-32 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILKEG+DPK+L DSEYPDWLWHLL+KRPALSELR KN+ETL Y LKRF KLDNR Sbjct: 59 VVGANILKEGTDPKILPDSEYPDWLWHLLDKRPALSELRRKNIETLSYEDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 RI E+NS+KAKN Sbjct: 119 ARIKESNSLKAKN 131 >XP_012457195.1 PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] XP_012457196.1 PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] KJB70837.1 hypothetical protein B456_011G092800 [Gossypium raimondii] KJB70839.1 hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 131 Score = 124 bits (310), Expect = 1e-32 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK++ DSEYPDW+WHLL+KRPALSELR KN+ETLPY LKRF KLDNR Sbjct: 59 VVGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNR 118 Query: 437 ERI*ENNSIKAKN 475 I ENNSIKAKN Sbjct: 119 ALIKENNSIKAKN 131 >XP_012458699.1 PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Gossypium raimondii] KJB74599.1 hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 144 Score = 124 bits (311), Expect = 1e-32 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGANILK+G+DPK+ DSEYPDWLWHLL+KRPALSELR K++ETLPY LKRF KLDNR Sbjct: 72 VVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNR 131 Query: 437 ERI*ENNSIKAKN 475 RI ENNS+KAKN Sbjct: 132 ARIKENNSVKAKN 144 >NP_566150.1 Mitochondrial ribosomal protein L37 [Arabidopsis thaliana] AAF01557.1 unknown protein [Arabidopsis thaliana] AAF03430.1 unknown protein [Arabidopsis thaliana] AAM64293.1 unknown [Arabidopsis thaliana] AAO41967.1 unknown protein [Arabidopsis thaliana] AAO50540.1 unknown protein [Arabidopsis thaliana] AEE73709.1 Mitochondrial ribosomal protein L37 [Arabidopsis thaliana] Length = 126 Score = 123 bits (309), Expect = 1e-32 Identities = 59/73 (80%), Positives = 64/73 (87%) Frame = +2 Query: 257 VVGANILKEGSDPKVLSDSEYPDWLWHLLEKRPALSELRMKNVETLPYGYLKRFFKLDNR 436 VVGAN LK+GSDPK+L DS+YPDWLWHLL+KRPALSELR KNVETLPY LKRF KLD R Sbjct: 54 VVGANTLKDGSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYDDLKRFVKLDTR 113 Query: 437 ERI*ENNSIKAKN 475 +I ENNSIKAKN Sbjct: 114 GKIKENNSIKAKN 126