BLASTX nr result
ID: Phellodendron21_contig00005498
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00005498 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015385970.1 PREDICTED: zinc finger BED domain-containing prot... 74 1e-13 KDO41413.1 hypothetical protein CISIN_1g007690mg [Citrus sinensis] 71 3e-12 XP_015385981.1 PREDICTED: zinc finger BED domain-containing prot... 66 1e-10 XP_006443028.1 hypothetical protein CICLE_v10019416mg [Citrus cl... 66 1e-10 XP_006478700.2 PREDICTED: zinc finger BED domain-containing prot... 66 1e-10 KDO39827.1 hypothetical protein CISIN_1g0013202mg, partial [Citr... 66 1e-10 XP_015385979.1 PREDICTED: zinc finger BED domain-containing prot... 65 2e-10 XP_015385977.1 PREDICTED: zinc finger BED domain-containing prot... 65 2e-10 XP_006433046.1 hypothetical protein CICLE_v10001117mg [Citrus cl... 65 4e-10 XP_015383835.1 PREDICTED: zinc finger BED domain-containing prot... 65 4e-10 KDO39270.1 hypothetical protein CISIN_1g007561mg [Citrus sinensis] 64 6e-10 XP_006443027.1 hypothetical protein CICLE_v10021729mg [Citrus cl... 63 8e-10 XP_006430500.1 hypothetical protein CICLE_v10011114mg [Citrus cl... 58 8e-08 XP_006443031.1 hypothetical protein CICLE_v10022852mg [Citrus cl... 53 1e-06 XP_015389263.1 PREDICTED: zinc finger BED domain-containing prot... 54 2e-06 KDO50658.1 hypothetical protein CISIN_1g0154451mg, partial [Citr... 54 2e-06 XP_006421011.1 hypothetical protein CICLE_v10004582mg [Citrus cl... 54 3e-06 XP_015386960.1 PREDICTED: zinc finger BED domain-containing prot... 54 3e-06 KDO39828.1 hypothetical protein CISIN_1g0013201mg, partial [Citr... 54 3e-06 >XP_015385970.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Citrus sinensis] Length = 330 Score = 73.9 bits (180), Expect = 1e-13 Identities = 50/113 (44%), Positives = 63/113 (55%), Gaps = 17/113 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALNKE---FSNTVID---ILRLFW- 131 KEAF ELG++D DF SINLT+QKWD+ TATFEHL L FS+ D I+ L + Sbjct: 71 KEAFFELGQLDSDFRSINLTEQKWDDVTATFEHLKFLKDAAVGFSSGKCDTPIIVDLPYV 130 Query: 130 -------CNRS-EDCHVCKYAPPQFKEFFEEN--KVYWVLVILDPRFKMDTIK 2 CN EDC CK + + N + + VILDPRFKMD ++ Sbjct: 131 HKILKDRCNHPIEDCLFCKKVMKAAIDLYFSNYYSIRAIAVILDPRFKMDGVQ 183 >KDO41413.1 hypothetical protein CISIN_1g007690mg [Citrus sinensis] Length = 593 Score = 70.9 bits (172), Expect = 3e-12 Identities = 51/116 (43%), Positives = 62/116 (53%), Gaps = 20/116 (17%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALNKEFSN----------TVIDI-- 146 KE FS L + D F SINLTKQKWDE TATFEHL L K+ ++ ++D+ Sbjct: 333 KEVFSALEQFDSKFWSINLTKQKWDEVTATFEHLKFL-KDVADGFFLGECGIPIIVDLPY 391 Query: 145 ---LRLFWCNRS-EDCHVC-KYAPPQFKEFFEENKVYWV---LVILDPRFKMDTIK 2 + CN EDC C K FF +K YWV VILDPRFKMD ++ Sbjct: 392 AHKILTDRCNHQIEDCLFCEKVMKEAIDRFF--SKCYWVRVIAVILDPRFKMDGMR 445 >XP_015385981.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 [Citrus sinensis] Length = 588 Score = 66.2 bits (160), Expect = 1e-10 Identities = 46/114 (40%), Positives = 62/114 (54%), Gaps = 18/114 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------NKEFSNTVIDI--- 146 KEAF ELG++D DF +INLT++KWDE TAT EHL L K + ++D+ Sbjct: 330 KEAFFELGQLDSDFRTINLTEKKWDEVTATLEHLKFLEDVAVGFSSGKCETPIIVDLPYV 389 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFFEENKVYW---VLVILDPRFKMDTIK 2 + CN +DC CK + F +K Y + VILDPRFKMD ++ Sbjct: 390 HKILKDRCNHPVDDCLFCKKVMKGAIDLF-FSKYYLIRVIAVILDPRFKMDGVQ 442 >XP_006443028.1 hypothetical protein CICLE_v10019416mg [Citrus clementina] ESR56268.1 hypothetical protein CICLE_v10019416mg [Citrus clementina] Length = 590 Score = 66.2 bits (160), Expect = 1e-10 Identities = 46/114 (40%), Positives = 62/114 (54%), Gaps = 18/114 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------NKEFSNTVIDI--- 146 KEAF ELG++D DF +INLT++KWDE TAT EHL L K + ++D+ Sbjct: 332 KEAFFELGQLDSDFRTINLTEKKWDEVTATLEHLKFLEDVAVGFSSGKCETPIIVDLPYV 391 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFFEENKVYW---VLVILDPRFKMDTIK 2 + CN +DC CK + F +K Y + VILDPRFKMD ++ Sbjct: 392 HKILKDRCNHPVDDCLFCKKVMKGAIDLF-FSKYYLIRVIAVILDPRFKMDGVQ 444 >XP_006478700.2 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Citrus sinensis] Length = 603 Score = 66.2 bits (160), Expect = 1e-10 Identities = 46/114 (40%), Positives = 62/114 (54%), Gaps = 18/114 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------NKEFSNTVIDI--- 146 KEAF ELG++D DF +INLT++KWDE TAT EHL L K + ++D+ Sbjct: 345 KEAFFELGQLDSDFRTINLTEKKWDEVTATLEHLKFLEDVAVGFSSGKCETPIIVDLPYV 404 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFFEENKVYW---VLVILDPRFKMDTIK 2 + CN +DC CK + F +K Y + VILDPRFKMD ++ Sbjct: 405 HKILKDRCNHPVDDCLFCKKVMKGAIDLF-FSKYYLIRVIAVILDPRFKMDGVQ 457 >KDO39827.1 hypothetical protein CISIN_1g0013202mg, partial [Citrus sinensis] Length = 632 Score = 66.2 bits (160), Expect = 1e-10 Identities = 46/114 (40%), Positives = 62/114 (54%), Gaps = 18/114 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------NKEFSNTVIDI--- 146 KEAF ELG++D DF +INLT++KWDE TAT EHL L K + ++D+ Sbjct: 374 KEAFFELGQLDSDFRTINLTEKKWDEVTATLEHLKFLEDVAVGFSSGKCETPIIVDLPYV 433 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFFEENKVYW---VLVILDPRFKMDTIK 2 + CN +DC CK + F +K Y + VILDPRFKMD ++ Sbjct: 434 HKILKDRCNHPVDDCLFCKKVMKGAIDLF-FSKYYLIRVIAVILDPRFKMDGVQ 486 >XP_015385979.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X2 [Citrus sinensis] Length = 609 Score = 65.5 bits (158), Expect = 2e-10 Identities = 45/113 (39%), Positives = 60/113 (53%), Gaps = 17/113 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------NKEFSNTVIDI--- 146 KE FS L + D +F SINL+KQKWDE TAT+EHL L + ++D+ Sbjct: 352 KEVFSALEQFDSEFRSINLSKQKWDEVTATYEHLKLLEDVSISISWERRDIPIIVDLPYV 411 Query: 145 --LRLFWCNRS-EDCHVC-KYAPPQFKEFFEEN-KVYWVLVILDPRFKMDTIK 2 + CN + EDC +C K FF +N V + VILDPR KMD ++ Sbjct: 412 HKILKDRCNHTIEDCLLCQKVMKGAIDLFFSKNYSVRVIAVILDPRLKMDGLQ 464 >XP_015385977.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X1 [Citrus sinensis] XP_015385978.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like isoform X1 [Citrus sinensis] Length = 614 Score = 65.5 bits (158), Expect = 2e-10 Identities = 45/113 (39%), Positives = 60/113 (53%), Gaps = 17/113 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------NKEFSNTVIDI--- 146 KE FS L + D +F SINL+KQKWDE TAT+EHL L + ++D+ Sbjct: 357 KEVFSALEQFDSEFRSINLSKQKWDEVTATYEHLKLLEDVSISISWERRDIPIIVDLPYV 416 Query: 145 --LRLFWCNRS-EDCHVC-KYAPPQFKEFFEEN-KVYWVLVILDPRFKMDTIK 2 + CN + EDC +C K FF +N V + VILDPR KMD ++ Sbjct: 417 HKILKDRCNHTIEDCLLCQKVMKGAIDLFFSKNYSVRVIAVILDPRLKMDGLQ 469 >XP_006433046.1 hypothetical protein CICLE_v10001117mg [Citrus clementina] ESR46286.1 hypothetical protein CICLE_v10001117mg [Citrus clementina] Length = 452 Score = 64.7 bits (156), Expect = 4e-10 Identities = 46/113 (40%), Positives = 58/113 (51%), Gaps = 17/113 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALNK---EFSNTVIDI--------- 146 KE F L ++D DF SINL+KQKWDE TATFEHL L + F DI Sbjct: 197 KEVFLGLEQLDSDFRSINLSKQKWDEVTATFEHLKFLKRLTISFMWGTCDIPIIVDLPYV 256 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFF--EENKVYWVLVILDPRFKMDTIK 2 + CN EDC C+ + + F + V + VILDPRFKMD ++ Sbjct: 257 HKILKDRCNHPIEDCPFCEKVMKKAIDIFFTKYYLVRVIAVILDPRFKMDGLQ 309 >XP_015383835.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Citrus sinensis] Length = 587 Score = 64.7 bits (156), Expect = 4e-10 Identities = 46/113 (40%), Positives = 58/113 (51%), Gaps = 17/113 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALNK---EFSNTVIDI--------- 146 KE F L ++D DF SINL+KQKWDE TATFEHL L + F DI Sbjct: 332 KEVFLGLEQLDSDFRSINLSKQKWDEVTATFEHLKFLKRLTISFMWGTCDIPIIVDLPYV 391 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFF--EENKVYWVLVILDPRFKMDTIK 2 + CN EDC C+ + + F + V + VILDPRFKMD ++ Sbjct: 392 HKILKDRCNHPIEDCPFCEKVMKKAIDIFFTKYYLVRVIAVILDPRFKMDGLQ 444 >KDO39270.1 hypothetical protein CISIN_1g007561mg [Citrus sinensis] Length = 598 Score = 64.3 bits (155), Expect = 6e-10 Identities = 46/113 (40%), Positives = 57/113 (50%), Gaps = 17/113 (15%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALNKE---FSNTVIDI--------- 146 KE FS L + D DF SINLTKQKW E TA FEHL LN F +DI Sbjct: 340 KEVFSALEQFDSDFRSINLTKQKWHEVTAAFEHLKFLNDVTDCFLWETLDIPIVVDLPYV 399 Query: 145 --LRLFWCNRS-EDCHVCKYAPPQFKEFF--EENKVYWVLVILDPRFKMDTIK 2 + CN EDC C+ + + F ++ V + ILDPRFKMD ++ Sbjct: 400 HKILTDRCNHPIEDCLFCQEVMKEAIDLFFSKQYLVRAIEFILDPRFKMDGLQ 452 >XP_006443027.1 hypothetical protein CICLE_v10021729mg [Citrus clementina] ESR56267.1 hypothetical protein CICLE_v10021729mg [Citrus clementina] Length = 263 Score = 63.2 bits (152), Expect = 8e-10 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---NKEFSNTVID 149 KEAF ELG++D DF SINLT+QKWDE TATFEHL L + FS+ V+D Sbjct: 71 KEAFFELGQLDSDFRSINLTEQKWDEVTATFEHLKFLKDADAGFSSVVLD 120 >XP_006430500.1 hypothetical protein CICLE_v10011114mg [Citrus clementina] ESR43740.1 hypothetical protein CICLE_v10011114mg [Citrus clementina] Length = 779 Score = 58.2 bits (139), Expect = 8e-08 Identities = 40/119 (33%), Positives = 53/119 (44%), Gaps = 23/119 (19%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------------NKEFSNTV 155 KE EL D +F S+NLTK+ W +AT +EH+ AL N F Sbjct: 510 KEVLCELVNADSNFKSMNLTKEDWQKATVAYEHIKALHDVACSLSESKCKTANAYFPKVC 569 Query: 154 IDILRLFWCNRSEDCHVCKYAPPQFKEFFEENKVYW--------VLVILDPRFKMDTIK 2 ++L RSED V K A + FF YW + +LDPRFKMD ++ Sbjct: 570 DIYMKLLQWERSEDDRVGKIALEAREIFFNR---YWMKYELILVIAAVLDPRFKMDIVQ 625 >XP_006443031.1 hypothetical protein CICLE_v10022852mg [Citrus clementina] ESR56271.1 hypothetical protein CICLE_v10022852mg [Citrus clementina] Length = 128 Score = 52.8 bits (125), Expect = 1e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 177 FNAFKCSNVAVASSHFCFVKFIEMKSGSIFPSSLNAS 287 F FKCSNVAV SSHFC VK I++KS S PSS NAS Sbjct: 60 FKNFKCSNVAVTSSHFCSVKLIDLKSESNCPSSKNAS 96 >XP_015389263.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like [Citrus sinensis] Length = 585 Score = 54.3 bits (129), Expect = 2e-06 Identities = 39/118 (33%), Positives = 62/118 (52%), Gaps = 23/118 (19%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALN---KEFSNT-----------VI 152 KEAF EL +D +F INL K++WD+ATA +E+L LN + S+T V Sbjct: 333 KEAFLELEVMDYEFKLINLAKEEWDKATAVYEYLKILNDAAQRLSDTKYTTANVFFPKVC 392 Query: 151 DI-LRLFWCNRSEDCHVCKYAPPQFKEFFEENKVYWV--------LVILDPRFKMDTI 5 ++ L L R+++ V + A + FF + YW+ ++LDPR+K+D + Sbjct: 393 ELYLNLLLWERADEYFVREIATGVKERFFSK---YWLNYKLYLATAIVLDPRYKLDIV 447 >KDO50658.1 hypothetical protein CISIN_1g0154451mg, partial [Citrus sinensis] Length = 347 Score = 53.9 bits (128), Expect = 2e-06 Identities = 39/118 (33%), Positives = 62/118 (52%), Gaps = 23/118 (19%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALN---KEFSNT-----------VI 152 KEAF EL +D +F INL K++WD+ATA +E+L LN + S+T V Sbjct: 159 KEAFWELEVMDYEFKLINLAKEEWDKATAVYEYLKILNGAAQRLSDTKYTTANVFFPKVC 218 Query: 151 DI-LRLFWCNRSEDCHVCKYAPPQFKEFFEENKVYWV--------LVILDPRFKMDTI 5 ++ L L R+++ V + A + FF + YW+ ++LDPR+K+D + Sbjct: 219 ELYLNLLLWERADEYFVREIATGVKERFFSK---YWLNYKLYLATAIVLDPRYKLDIV 273 >XP_006421011.1 hypothetical protein CICLE_v10004582mg [Citrus clementina] ESR34251.1 hypothetical protein CICLE_v10004582mg [Citrus clementina] Length = 603 Score = 53.9 bits (128), Expect = 3e-06 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 23/118 (19%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNALN---KEFSNTVIDILRLFW---- 131 KEAF EL +D +F INL K++WD+ATA +E+L LN + S+T +F+ Sbjct: 351 KEAFWELEVMDYEFKLINLAKEEWDKATAVYEYLKILNGAAQRLSDTKYTTANVFFPKVC 410 Query: 130 --------CNRSEDCHVCKYAPPQFKEFFEENKVYWV--------LVILDPRFKMDTI 5 R+++ V + A + FF + YW+ ++LDPR+K+D + Sbjct: 411 ELYLKFLLWERADEYFVREIATGVKERFFSK---YWLNYKLYLAAAIVLDPRYKLDIV 465 >XP_015386960.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Citrus sinensis] Length = 446 Score = 53.5 bits (127), Expect = 3e-06 Identities = 39/119 (32%), Positives = 54/119 (45%), Gaps = 23/119 (19%) Frame = -1 Query: 289 KEAFSELGKIDPDFISINLTKQKWDEATATFEHLNAL---------------NKEFSNTV 155 K+ EL D +F S+NLTK+ W +AT +EH+ AL N F Sbjct: 175 KKVLCELVNADSNFKSMNLTKEDWQKATVAYEHIKALHDVACSLSESKCKTANAYFPKVC 234 Query: 154 IDILRLFWCNRSEDCHVCKYAPPQFKEFFEENKVYW--------VLVILDPRFKMDTIK 2 ++L RSED V K A + +E F YW + +LDPRFKMD ++ Sbjct: 235 DIYMKLLQWERSEDDCVGKIA-LEAREIFVNR--YWMKYELILVIAAVLDPRFKMDIVQ 290 >KDO39828.1 hypothetical protein CISIN_1g0013201mg, partial [Citrus sinensis] Length = 468 Score = 53.5 bits (127), Expect = 3e-06 Identities = 35/90 (38%), Positives = 43/90 (47%) Frame = -1 Query: 271 LGKIDPDFISINLTKQKWDEATATFEHLNALNKEFSNTVIDILRLFWCNRSEDCHVCKYA 92 L ++D DF SI TKQKWDE TATFEHL L E ID Sbjct: 335 LEQLDSDFRSIKFTKQKWDEITATFEHLKLLKYE----AID------------------- 371 Query: 91 PPQFKEFFEENKVYWVLVILDPRFKMDTIK 2 P F +++ + ILDPRFKMD ++ Sbjct: 372 -PLFSKYYLARV---IAAILDPRFKMDAVQ 397