BLASTX nr result
ID: Phellodendron21_contig00005359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00005359 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERM99912.1 hypothetical protein AMTR_s00110p00072260 [Amborella ... 52 2e-06 >ERM99912.1 hypothetical protein AMTR_s00110p00072260 [Amborella trichopoda] Length = 51 Score = 51.6 bits (122), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 AAIIADVLENAEANRVINASQKRALLQEMA 92 AAIIADVLENAE+NR+I SQKRALLQEMA Sbjct: 18 AAIIADVLENAESNRIITPSQKRALLQEMA 47