BLASTX nr result
ID: Phellodendron21_contig00004748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00004748 (1426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415931.1 hypothetical protein MELLADRAFT_73117 [Melampsora... 75 3e-12 OAV87425.1 hypothetical protein PTTG_29438, partial [Puccinia tr... 66 1e-08 KNF03989.1 hypothetical protein PSTG_02699 [Puccinia striiformis... 60 1e-07 XP_003328313.1 hypothetical protein PGTG_09607 [Puccinia gramini... 57 2e-06 >XP_007415931.1 hypothetical protein MELLADRAFT_73117 [Melampsora larici-populina 98AG31] EGG00857.1 hypothetical protein MELLADRAFT_73117 [Melampsora larici-populina 98AG31] Length = 168 Score = 75.1 bits (183), Expect = 3e-12 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 2/101 (1%) Frame = -1 Query: 868 SHRRSSRPEPEIKARSTDAAIPGSFGPALLDDGTHPYYPGTPWHKLELASTIDERCKPR- 692 S +++S P+ + IP + PALL+DG+HPYYPGTPW LEL STID+ CKPR Sbjct: 58 SEQKASNPQTS----NDQLTIPENLRPALLEDGSHPYYPGTPWGDLELGSTIDDGCKPRR 113 Query: 691 -SGILPSMMNRRPRGVFKRRLRRKSESEIRYELPPYFGSPL 572 S +LP + F+R+ R + S L P P+ Sbjct: 114 DSQLLPKRLR-----AFRRKTRHSTASAFPGSLQPMKAPPV 149 >OAV87425.1 hypothetical protein PTTG_29438, partial [Puccinia triticina 1-1 BBBD Race 1] Length = 214 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/93 (40%), Positives = 47/93 (50%), Gaps = 16/93 (17%) Frame = -1 Query: 925 NTSEMRMVISGWLAQARKLSHRRSSRP----------------EPEIKARSTDAAIPGSF 794 N ++S W AQAR RRSS P +P+ K R S Sbjct: 103 NPRSRMCILSHWWAQARA-GPRRSSSPSAFLGAPVVLPSAKTDDPDEKLRMRTPTSAESL 161 Query: 793 GPALLDDGTHPYYPGTPWHKLELASTIDERCKP 695 PALLDDG HPY+PGTPW++LELA+T+D P Sbjct: 162 RPALLDDGCHPYFPGTPWNQLELAATVDPSHHP 194 >KNF03989.1 hypothetical protein PSTG_02699 [Puccinia striiformis f. sp. tritici PST-78] KNF04585.1 hypothetical protein PSTG_02496 [Puccinia striiformis f. sp. tritici PST-78] Length = 103 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 790 PALLDDGTHPYYPGTPWHKLELASTIDERCKPR 692 P LLDDG+HPY+PGTPW++LELA TID R +PR Sbjct: 58 PVLLDDGSHPYFPGTPWNELELAGTIDARHQPR 90 >XP_003328313.1 hypothetical protein PGTG_09607 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP83894.1 hypothetical protein PGTG_09607 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 108 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/83 (40%), Positives = 46/83 (55%), Gaps = 17/83 (20%) Frame = -1 Query: 904 VISGWLAQARKLSHRR--SSRPEPEI--KARSTDAAI-------------PGSFGPALLD 776 +IS W +QAR S R SS P I + +S D+ + P L+D Sbjct: 3 IISYWWSQARVASWRSPPSSISSPAILPREKSQDSVTRHDEAFAVRKRKSDETLRPVLMD 62 Query: 775 DGTHPYYPGTPWHKLELASTIDE 707 DG+HPY+PGTPW++LELA TID+ Sbjct: 63 DGSHPYFPGTPWNELELAGTIDK 85