BLASTX nr result
ID: Phellodendron21_contig00004725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00004725 (1050 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHG23587.1 hypothetical protein F383_28973 [Gossypium arboreum] 71 4e-11 >KHG23587.1 hypothetical protein F383_28973 [Gossypium arboreum] Length = 179 Score = 71.2 bits (173), Expect = 4e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 206 QGIISNGSLVHQEKENMCVCLLSPFLNTASFFPTLPPYLP 325 +GIISNGSLVH+EKENMCVCLLSPFLNTAS F TL PYLP Sbjct: 136 KGIISNGSLVHREKENMCVCLLSPFLNTASLFLTL-PYLP 174