BLASTX nr result
ID: Phellodendron21_contig00003245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00003245 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO58421.1 hypothetical protein CISIN_1g024579mg [Citrus sinensis] 77 3e-14 XP_006447758.1 hypothetical protein CICLE_v10016280mg [Citrus cl... 77 3e-14 KHL91138.1 hypothetical protein QW71_36380, partial [Paenibacill... 71 1e-12 XP_007049308.1 PREDICTED: chlorophyll a-b binding protein 151, c... 70 1e-11 NP_001295615.1 chlorophyll a-b binding protein 151, chloroplasti... 68 4e-11 OMO98495.1 Chlorophyll A-B binding protein, plant [Corchorus cap... 68 4e-11 XP_016745888.1 PREDICTED: chlorophyll a-b binding protein 151, c... 68 4e-11 XP_016745886.1 PREDICTED: chlorophyll a-b binding protein 151, c... 68 4e-11 XP_012485857.1 PREDICTED: chlorophyll a-b binding protein 151, c... 68 4e-11 XP_012485815.1 PREDICTED: chlorophyll a-b binding protein 151, c... 68 4e-11 XP_012081439.1 PREDICTED: chlorophyll a-b binding protein 151, c... 68 4e-11 XP_002531690.1 PREDICTED: chlorophyll a-b binding protein 151, c... 68 5e-11 XP_012490272.1 PREDICTED: chlorophyll a-b binding protein 151, c... 67 7e-11 AAC34983.1 light harvesting chlorophyll A/B binding protein [Pru... 67 7e-11 XP_007215825.1 hypothetical protein PRUPE_ppa010078mg [Prunus pe... 67 7e-11 JAU21406.1 Chlorophyll a-b binding protein 37, chloroplastic, pa... 64 7e-11 XP_010112785.1 Chlorophyll a-b binding protein 151 [Morus notabi... 67 1e-10 XP_016746131.1 PREDICTED: chlorophyll a-b binding protein 151, c... 67 1e-10 CAA84525.1 chlorophyll a,b binding protein type I [Solanum tuber... 67 1e-10 OMP08321.1 Chlorophyll A-B binding protein, plant [Corchorus oli... 66 2e-10 >KDO58421.1 hypothetical protein CISIN_1g024579mg [Citrus sinensis] Length = 265 Score = 76.6 bits (187), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTALRQSNEFV KVG+ DGGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTV 41 >XP_006447758.1 hypothetical protein CICLE_v10016280mg [Citrus clementina] XP_006469510.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Citrus sinensis] ESR60998.1 hypothetical protein CICLE_v10016280mg [Citrus clementina] Length = 265 Score = 76.6 bits (187), Expect = 3e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTALRQSNEFV KVG+ DGGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTV 41 >KHL91138.1 hypothetical protein QW71_36380, partial [Paenibacillus sp. IHB B 3415] Length = 191 Score = 70.9 bits (172), Expect = 1e-12 Identities = 40/69 (57%), Positives = 47/69 (68%), Gaps = 3/69 (4%) Frame = +1 Query: 193 YKLLCIFRVQEK---KHLPQKKSFH*RKMATSAIQQSAFAGQTALRQSNEFVHKVGIVDG 363 +++ C F K KH Q++S H MATSAIQQSAFAGQTAL+ NE V K+G G Sbjct: 1 WQVTCFFPTTNKPTEKHQHQQRSSH-AVMATSAIQQSAFAGQTALKPQNELVRKIGSFGG 59 Query: 364 GRITMRRTV 390 GRITMRRTV Sbjct: 60 GRITMRRTV 68 >XP_007049308.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Theobroma cacao] EOX93465.1 Photosystem II light harvesting complex gene 2.1 [Theobroma cacao] Length = 265 Score = 69.7 bits (169), Expect = 1e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V KVG+ GGR+TMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVRKVGVFGGGRVTMRRTV 41 >NP_001295615.1 chlorophyll a-b binding protein 151, chloroplastic [Jatropha curcas] ACX54226.1 chlorophyll A/B binding protein [Jatropha curcas] Length = 261 Score = 68.2 bits (165), Expect = 4e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V KVG GGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTV 41 >OMO98495.1 Chlorophyll A-B binding protein, plant [Corchorus capsularis] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V KVG GGR+TMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVRKVGAFGGGRVTMRRTV 41 >XP_016745888.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like [Gossypium hirsutum] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAF GQTAL+QSNE + KVG DGGR+TMRRTV Sbjct: 1 MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTV 41 >XP_016745886.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like [Gossypium hirsutum] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAF GQTAL+QSNE + KVG DGGR+TMRRTV Sbjct: 1 MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTV 41 >XP_012485857.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like [Gossypium raimondii] KJB06801.1 hypothetical protein B456_001G192300 [Gossypium raimondii] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAF GQTAL+QSNE + KVG DGGR+TMRRTV Sbjct: 1 MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTV 41 >XP_012485815.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like [Gossypium raimondii] KJB06589.1 hypothetical protein B456_001G192000 [Gossypium raimondii] KJB06590.1 hypothetical protein B456_001G192000 [Gossypium raimondii] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAF GQTAL+QSNE + KVG DGGR+TMRRTV Sbjct: 1 MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTV 41 >XP_012081439.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Jatropha curcas] KDP29912.1 hypothetical protein JCGZ_18481 [Jatropha curcas] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V KVG GGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTV 41 >XP_002531690.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Ricinus communis] EEF30681.1 chlorophyll A/B binding protein, putative [Ricinus communis] Length = 265 Score = 67.8 bits (164), Expect = 5e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+ SNE V KVG V GGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKPSNELVRKVGSVGGGRITMRRTV 41 >XP_012490272.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Gossypium raimondii] KJB10748.1 hypothetical protein B456_001G220900 [Gossypium raimondii] Length = 265 Score = 67.4 bits (163), Expect = 7e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V KVG V GGR++MRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVCKVGAVGGGRVSMRRTV 41 >AAC34983.1 light harvesting chlorophyll A/B binding protein [Prunus persica] Length = 265 Score = 67.4 bits (163), Expect = 7e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE + K+G + GGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTV 41 >XP_007215825.1 hypothetical protein PRUPE_ppa010078mg [Prunus persica] ONI18176.1 hypothetical protein PRUPE_3G201000 [Prunus persica] ONI18177.1 hypothetical protein PRUPE_3G201000 [Prunus persica] Length = 265 Score = 67.4 bits (163), Expect = 7e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE + K+G + GGRITMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTV 41 >JAU21406.1 Chlorophyll a-b binding protein 37, chloroplastic, partial [Noccaea caerulescens] JAU76502.1 Chlorophyll a-b binding protein 37, chloroplastic, partial [Noccaea caerulescens] Length = 80 Score = 63.5 bits (153), Expect = 7e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQS+FAGQTAL+ SN+ + KVG+ GGR+TMRRTV Sbjct: 1 MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTV 41 >XP_010112785.1 Chlorophyll a-b binding protein 151 [Morus notabilis] EXC34900.1 Chlorophyll a-b binding protein 151 [Morus notabilis] Length = 265 Score = 67.0 bits (162), Expect = 1e-10 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V K G V GGR TMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVRKAGAVGGGRATMRRTV 41 >XP_016746131.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Gossypium hirsutum] XP_016746212.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Gossypium hirsutum] XP_017625290.1 PREDICTED: chlorophyll a-b binding protein 151, chloroplastic [Gossypium arboreum] P27518.2 RecName: Full=Chlorophyll a-b binding protein 151, chloroplastic; AltName: Full=LHCII type II CAB-151; Short=LHCP; Flags: Precursor CAA38025.1 chlorophyll ab binding protein [Gossypium hirsutum] KHG21776.1 Chlorophyll a-b binding protein, chloroplastic [Gossypium arboreum] Length = 265 Score = 67.0 bits (162), Expect = 1e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V K+G V GGR++MRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTV 41 >CAA84525.1 chlorophyll a,b binding protein type I [Solanum tuberosum] Length = 265 Score = 67.0 bits (162), Expect = 1e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+ NEF+ K+G +GGR+TMRRTV Sbjct: 1 MATSAIQQSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTV 41 >OMP08321.1 Chlorophyll A-B binding protein, plant [Corchorus olitorius] Length = 265 Score = 66.2 bits (160), Expect = 2e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 268 MATSAIQQSAFAGQTALRQSNEFVHKVGIVDGGRITMRRTV 390 MATSAIQQSAFAGQTAL+QSNE V KVG GGR+ MRRTV Sbjct: 1 MATSAIQQSAFAGQTALKQSNELVRKVGAFGGGRVAMRRTV 41