BLASTX nr result
ID: Phellodendron21_contig00003077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00003077 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV76557.1 hypothetical protein CFOL_v3_20030 [Cephalotus follic... 142 4e-41 XP_006480862.1 PREDICTED: high-light-induced protein, chloroplas... 140 2e-40 XP_006429136.1 hypothetical protein CICLE_v10013078mg [Citrus cl... 139 7e-40 XP_011077635.1 PREDICTED: high-light-induced protein, chloroplas... 137 2e-39 OMO97237.1 hypothetical protein COLO4_14759 [Corchorus olitorius] 137 2e-39 OMO66369.1 hypothetical protein CCACVL1_21195 [Corchorus capsula... 137 2e-39 KVH90299.1 Chlorophyll a/b binding protein domain-containing pro... 137 6e-39 XP_012074977.1 PREDICTED: high-light-induced protein, chloroplas... 135 9e-39 XP_010262565.1 PREDICTED: light-harvesting complex-like protein ... 135 1e-38 XP_015896990.1 PREDICTED: high-light-induced protein, chloroplas... 135 1e-38 XP_002270357.1 PREDICTED: light-harvesting complex-like protein ... 135 2e-38 OAY41343.1 hypothetical protein MANES_09G093900 [Manihot esculenta] 134 3e-38 XP_007206163.1 hypothetical protein PRUPE_ppa013648mg [Prunus pe... 134 3e-38 ONI03475.1 hypothetical protein PRUPE_6G259200 [Prunus persica] ... 134 4e-38 XP_011019820.1 PREDICTED: high-light-induced protein, chloroplas... 134 5e-38 XP_002309074.2 hypothetical protein POPTR_0006s08850g [Populus t... 134 5e-38 XP_010037809.1 PREDICTED: high-light-induced protein, chloroplas... 134 6e-38 XP_018841680.1 PREDICTED: high-light-induced protein, chloroplas... 133 8e-38 XP_008240618.1 PREDICTED: high-light-induced protein, chloroplas... 133 1e-37 XP_008387800.1 PREDICTED: high-light-induced protein, chloroplas... 132 2e-37 >GAV76557.1 hypothetical protein CFOL_v3_20030 [Cephalotus follicularis] Length = 120 Score = 142 bits (357), Expect = 4e-41 Identities = 68/74 (91%), Positives = 72/74 (97%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+ QAAK PAGV+LP+VQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 47 FRTQAAKLPAGVELPKVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 106 Query: 232 VIGVEIGKGLDLPL 191 VIGVE+GKGLDLPL Sbjct: 107 VIGVEVGKGLDLPL 120 >XP_006480862.1 PREDICTED: high-light-induced protein, chloroplastic [Citrus sinensis] KDO52358.1 hypothetical protein CISIN_1g032628mg [Citrus sinensis] Length = 137 Score = 140 bits (353), Expect = 2e-40 Identities = 67/74 (90%), Positives = 72/74 (97%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+VQAAK P+GVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIG++ TFIVELILNKGILQ Sbjct: 64 FRVQAAKIPSGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGIVFTFIVELILNKGILQ 123 Query: 232 VIGVEIGKGLDLPL 191 VIGVE+GKGLDLPL Sbjct: 124 VIGVEVGKGLDLPL 137 >XP_006429136.1 hypothetical protein CICLE_v10013078mg [Citrus clementina] ESR42376.1 hypothetical protein CICLE_v10013078mg [Citrus clementina] Length = 137 Score = 139 bits (350), Expect = 7e-40 Identities = 66/74 (89%), Positives = 72/74 (97%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+V+AAK P+GVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIG++ TFIVELILNKGILQ Sbjct: 64 FRVEAAKIPSGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGIVFTFIVELILNKGILQ 123 Query: 232 VIGVEIGKGLDLPL 191 VIGVE+GKGLDLPL Sbjct: 124 VIGVEVGKGLDLPL 137 >XP_011077635.1 PREDICTED: high-light-induced protein, chloroplastic [Sesamum indicum] Length = 111 Score = 137 bits (345), Expect = 2e-39 Identities = 63/74 (85%), Positives = 72/74 (97%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 FK+QAAK PAGV++P+ QPKF+APFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 38 FKIQAAKLPAGVEMPKQQPKFEAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQ 97 Query: 232 VIGVEIGKGLDLPL 191 +IGV++GKGLDLPL Sbjct: 98 IIGVDVGKGLDLPL 111 >OMO97237.1 hypothetical protein COLO4_14759 [Corchorus olitorius] Length = 112 Score = 137 bits (345), Expect = 2e-39 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 FKVQAAK PAGV++P+VQPKF APFLGFTKTAE+WNSRACMIGLIG FIVELI+NKGILQ Sbjct: 39 FKVQAAKLPAGVEVPKVQPKFNAPFLGFTKTAEVWNSRACMIGLIGVFIVELIINKGILQ 98 Query: 232 VIGVEIGKGLDLPL 191 VIGV++GKGLDLPL Sbjct: 99 VIGVDVGKGLDLPL 112 >OMO66369.1 hypothetical protein CCACVL1_21195 [Corchorus capsularis] Length = 112 Score = 137 bits (345), Expect = 2e-39 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 FKVQAAK PAGV++P+VQPKF APFLGFTKTAE+WNSRACMIGLIG FIVELI+NKGILQ Sbjct: 39 FKVQAAKLPAGVEVPKVQPKFNAPFLGFTKTAEVWNSRACMIGLIGVFIVELIINKGILQ 98 Query: 232 VIGVEIGKGLDLPL 191 VIGV++GKGLDLPL Sbjct: 99 VIGVDVGKGLDLPL 112 >KVH90299.1 Chlorophyll a/b binding protein domain-containing protein [Cynara cardunculus var. scolymus] Length = 141 Score = 137 bits (344), Expect = 6e-39 Identities = 63/74 (85%), Positives = 72/74 (97%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 FK+QAAK PAGV++P+ +PKFQAPFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGIL+ Sbjct: 68 FKIQAAKLPAGVEIPKAEPKFQAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILE 127 Query: 232 VIGVEIGKGLDLPL 191 +IGVEIGKGLD+PL Sbjct: 128 MIGVEIGKGLDIPL 141 >XP_012074977.1 PREDICTED: high-light-induced protein, chloroplastic [Jatropha curcas] KDP35667.1 hypothetical protein JCGZ_09105 [Jatropha curcas] Length = 118 Score = 135 bits (341), Expect = 9e-39 Identities = 63/74 (85%), Positives = 73/74 (98%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+V+AA+ P+GV+LP+V+PKF+APFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 45 FRVRAARLPSGVELPKVEPKFKAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQ 104 Query: 232 VIGVEIGKGLDLPL 191 VIGVE+GKGLDLPL Sbjct: 105 VIGVEVGKGLDLPL 118 >XP_010262565.1 PREDICTED: light-harvesting complex-like protein OHP1, chloroplastic [Nelumbo nucifera] Length = 115 Score = 135 bits (340), Expect = 1e-38 Identities = 63/74 (85%), Positives = 72/74 (97%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+V+AAK P GV++P+V+PKFQ+PFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 42 FRVRAAKLPPGVEVPKVEPKFQSPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 101 Query: 232 VIGVEIGKGLDLPL 191 VIGV++GKGLDLPL Sbjct: 102 VIGVDVGKGLDLPL 115 >XP_015896990.1 PREDICTED: high-light-induced protein, chloroplastic [Ziziphus jujuba] Length = 119 Score = 135 bits (340), Expect = 1e-38 Identities = 63/74 (85%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+VQAAK PAGV++P+V+PKF PFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 46 FRVQAAKLPAGVEVPKVEPKFNPPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 105 Query: 232 VIGVEIGKGLDLPL 191 VIGV++GKGLD+PL Sbjct: 106 VIGVDVGKGLDIPL 119 >XP_002270357.1 PREDICTED: light-harvesting complex-like protein OHP1, chloroplastic [Vitis vinifera] CBI30519.3 unnamed protein product, partial [Vitis vinifera] Length = 121 Score = 135 bits (339), Expect = 2e-38 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+VQAAK P GV+LP+V+PKF+APFLGFT+TAEIWNSRACMIGLIG FIVELILNKGILQ Sbjct: 48 FRVQAAKLPPGVELPKVEPKFEAPFLGFTRTAEIWNSRACMIGLIGIFIVELILNKGILQ 107 Query: 232 VIGVEIGKGLDLPL 191 VIGV+IGKGLDLPL Sbjct: 108 VIGVDIGKGLDLPL 121 >OAY41343.1 hypothetical protein MANES_09G093900 [Manihot esculenta] Length = 118 Score = 134 bits (338), Expect = 3e-38 Identities = 63/74 (85%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 FKV+AAK PA V+LP+V+PKFQAPFLGFT+TAEIWNSRACMIG++GTFIVE ILNKGILQ Sbjct: 45 FKVRAAKVPASVELPKVEPKFQAPFLGFTRTAEIWNSRACMIGIMGTFIVEFILNKGILQ 104 Query: 232 VIGVEIGKGLDLPL 191 VIGVE+GKGLDLPL Sbjct: 105 VIGVEVGKGLDLPL 118 >XP_007206163.1 hypothetical protein PRUPE_ppa013648mg [Prunus persica] Length = 111 Score = 134 bits (337), Expect = 3e-38 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+VQAAK PAGV +P+V+PKF APFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 38 FRVQAAKLPAGVVVPKVEPKFAAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQ 97 Query: 232 VIGVEIGKGLDLPL 191 +IGVEIGKGLD+PL Sbjct: 98 LIGVEIGKGLDIPL 111 >ONI03475.1 hypothetical protein PRUPE_6G259200 [Prunus persica] ONI03476.1 hypothetical protein PRUPE_6G259200 [Prunus persica] Length = 119 Score = 134 bits (337), Expect = 4e-38 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F+VQAAK PAGV +P+V+PKF APFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 46 FRVQAAKLPAGVVVPKVEPKFAAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQ 105 Query: 232 VIGVEIGKGLDLPL 191 +IGVEIGKGLD+PL Sbjct: 106 LIGVEIGKGLDIPL 119 >XP_011019820.1 PREDICTED: high-light-induced protein, chloroplastic [Populus euphratica] Length = 119 Score = 134 bits (336), Expect = 5e-38 Identities = 61/74 (82%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F++QAAK P GV+LP+V+PKFQAPFLGFT+TAEIWNSRACM+GLIG F+VELI+NKGILQ Sbjct: 46 FRIQAAKLPPGVELPKVEPKFQAPFLGFTRTAEIWNSRACMMGLIGVFVVELIINKGILQ 105 Query: 232 VIGVEIGKGLDLPL 191 VIGV+IGKGLDLPL Sbjct: 106 VIGVDIGKGLDLPL 119 >XP_002309074.2 hypothetical protein POPTR_0006s08850g [Populus trichocarpa] EEE92597.2 hypothetical protein POPTR_0006s08850g [Populus trichocarpa] Length = 119 Score = 134 bits (336), Expect = 5e-38 Identities = 61/74 (82%), Positives = 71/74 (95%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F++QAAK P GV+LP+V+PKFQAPFLGFT+TAEIWNSRACM+GLIG F+VELI+NKGILQ Sbjct: 46 FRIQAAKLPPGVELPKVEPKFQAPFLGFTRTAEIWNSRACMMGLIGVFVVELIINKGILQ 105 Query: 232 VIGVEIGKGLDLPL 191 VIGV+IGKGLDLPL Sbjct: 106 VIGVDIGKGLDLPL 119 >XP_010037809.1 PREDICTED: high-light-induced protein, chloroplastic [Eucalyptus grandis] KCW49556.1 hypothetical protein EUGRSUZ_K03081 [Eucalyptus grandis] Length = 121 Score = 134 bits (336), Expect = 6e-38 Identities = 61/73 (83%), Positives = 72/73 (98%) Frame = -2 Query: 409 KVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQV 230 +V+AAK P+GV++P+V+PKFQAPFLGFT+TAE+WNSRACMIGLIGTFIVELI+NKGILQV Sbjct: 49 RVRAAKLPSGVEVPKVEPKFQAPFLGFTRTAEVWNSRACMIGLIGTFIVELIINKGILQV 108 Query: 229 IGVEIGKGLDLPL 191 IGVE+GKGLDLPL Sbjct: 109 IGVEVGKGLDLPL 121 >XP_018841680.1 PREDICTED: high-light-induced protein, chloroplastic [Juglans regia] Length = 118 Score = 133 bits (335), Expect = 8e-38 Identities = 62/74 (83%), Positives = 70/74 (94%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F++ AAK PAGV++P+ +PKF APFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 45 FRIHAAKLPAGVEVPKTEPKFSAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQ 104 Query: 232 VIGVEIGKGLDLPL 191 +IGVEIGKGLDLPL Sbjct: 105 LIGVEIGKGLDLPL 118 >XP_008240618.1 PREDICTED: high-light-induced protein, chloroplastic [Prunus mume] Length = 119 Score = 133 bits (334), Expect = 1e-37 Identities = 63/73 (86%), Positives = 71/73 (97%) Frame = -2 Query: 409 KVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQV 230 +VQAAK PAGV +P+V+PKF+APFLGFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ+ Sbjct: 47 RVQAAKLPAGVVVPKVEPKFEAPFLGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQL 106 Query: 229 IGVEIGKGLDLPL 191 IGVEIGKGLD+PL Sbjct: 107 IGVEIGKGLDIPL 119 >XP_008387800.1 PREDICTED: high-light-induced protein, chloroplastic [Malus domestica] XP_008359741.1 PREDICTED: high-light-induced protein, chloroplastic-like [Malus domestica] Length = 111 Score = 132 bits (331), Expect = 2e-37 Identities = 63/74 (85%), Positives = 70/74 (94%) Frame = -2 Query: 412 FKVQAAKFPAGVDLPRVQPKFQAPFLGFTKTAEIWNSRACMIGLIGTFIVELILNKGILQ 233 F VQAAK PAGV +P+V+PKF+APF GFT+TAEIWNSRACMIGLIGTFIVELILNKGILQ Sbjct: 38 FTVQAAKLPAGVVVPKVEPKFKAPFAGFTRTAEIWNSRACMIGLIGTFIVELILNKGILQ 97 Query: 232 VIGVEIGKGLDLPL 191 +IGVEIGKGLD+PL Sbjct: 98 LIGVEIGKGLDIPL 111