BLASTX nr result
ID: Phellodendron21_contig00002338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00002338 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO51593.1 hypothetical protein CISIN_1g045664mg [Citrus sinensis] 59 3e-09 >KDO51593.1 hypothetical protein CISIN_1g045664mg [Citrus sinensis] Length = 68 Score = 59.3 bits (142), Expect = 3e-09 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = -2 Query: 427 ILLALGIFMAALVLFTPSEVAARNLAETSINMQKAEEATKTNGDNYLGYPSSRVGCP 257 I+L LG+ MA LVL T SEVAARNLAETS NM+KAE ATK ++ S VGCP Sbjct: 5 IILLLGLAMA-LVLLTSSEVAARNLAETSTNMRKAEAATKNTFVKFIPSLYSPVGCP 60