BLASTX nr result
ID: Phellodendron21_contig00002337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00002337 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO51593.1 hypothetical protein CISIN_1g045664mg [Citrus sinensis] 57 2e-08 >KDO51593.1 hypothetical protein CISIN_1g045664mg [Citrus sinensis] Length = 68 Score = 57.4 bits (137), Expect = 2e-08 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = +2 Query: 2 ILLALGIVMAALVLFTPSEVAARNLAETSINIQKDEEATKTNGDNYLGNPSSGVGCP 172 I+L LG+ MA LVL T SEVAARNLAETS N++K E ATK ++ + S VGCP Sbjct: 5 IILLLGLAMA-LVLLTSSEVAARNLAETSTNMRKAEAATKNTFVKFIPSLYSPVGCP 60