BLASTX nr result
ID: Phellodendron21_contig00002266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00002266 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011009149.1 PREDICTED: mitochondrial uncoupling protein 1 [Po... 61 1e-08 XP_002322953.1 UNCOUPLING family protein [Populus trichocarpa] E... 61 1e-08 XP_012087936.1 PREDICTED: mitochondrial uncoupling protein 1 iso... 59 9e-08 KDO58038.1 hypothetical protein CISIN_1g021868mg [Citrus sinensi... 59 9e-08 XP_006429270.1 hypothetical protein CICLE_v10012294mg [Citrus cl... 59 9e-08 CDP06526.1 unnamed protein product [Coffea canephora] 59 9e-08 XP_012850228.1 PREDICTED: mitochondrial uncoupling protein 1 [Er... 58 1e-07 AJC97779.1 mitochondrial uncoupling protein, partial [Actinidia ... 57 2e-07 AFK41504.1 unknown [Medicago truncatula] 54 2e-07 OAY43654.1 hypothetical protein MANES_08G086800 [Manihot esculenta] 58 2e-07 OAY41431.1 hypothetical protein MANES_09G101300 [Manihot esculenta] 58 2e-07 XP_008448974.1 PREDICTED: mitochondrial uncoupling protein 1 [Cu... 57 2e-07 XP_004147893.1 PREDICTED: mitochondrial uncoupling protein 1 [Cu... 57 2e-07 XP_018838206.1 PREDICTED: mitochondrial uncoupling protein 1-lik... 57 2e-07 XP_015897075.1 PREDICTED: mitochondrial uncoupling protein 1 [Zi... 57 2e-07 XP_008239736.1 PREDICTED: mitochondrial uncoupling protein 1 [Pr... 57 2e-07 XP_007205615.1 hypothetical protein PRUPE_ppa009102mg [Prunus pe... 57 2e-07 XP_007026812.2 PREDICTED: mitochondrial uncoupling protein 1 [Th... 57 5e-07 XP_011019168.1 PREDICTED: mitochondrial uncoupling protein 1-lik... 57 5e-07 EOY07314.1 Plant uncoupling mitochondrial protein 1 [Theobroma c... 57 5e-07 >XP_011009149.1 PREDICTED: mitochondrial uncoupling protein 1 [Populus euphratica] Length = 307 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESSRA 90 FGRLGSWNVIMFLTLEQAKKFVRS+ESSRA Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSLESSRA 307 >XP_002322953.1 UNCOUPLING family protein [Populus trichocarpa] EEF04714.1 UNCOUPLING family protein [Populus trichocarpa] Length = 307 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESSRA 90 FGRLGSWNVIMFLTLEQAKKFVRS+ESSRA Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSLESSRA 307 >XP_012087936.1 PREDICTED: mitochondrial uncoupling protein 1 isoform X2 [Jatropha curcas] KDP24500.1 hypothetical protein JCGZ_25064 [Jatropha curcas] Length = 305 Score = 58.5 bits (140), Expect = 9e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRSIESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSIESS 305 >KDO58038.1 hypothetical protein CISIN_1g021868mg [Citrus sinensis] KDO58039.1 hypothetical protein CISIN_1g021868mg [Citrus sinensis] Length = 306 Score = 58.5 bits (140), Expect = 9e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRSIESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSIESS 305 >XP_006429270.1 hypothetical protein CICLE_v10012294mg [Citrus clementina] XP_006480945.1 PREDICTED: mitochondrial uncoupling protein 1 [Citrus sinensis] ESR42510.1 hypothetical protein CICLE_v10012294mg [Citrus clementina] Length = 306 Score = 58.5 bits (140), Expect = 9e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRSIESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSIESS 305 >CDP06526.1 unnamed protein product [Coffea canephora] Length = 307 Score = 58.5 bits (140), Expect = 9e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRSIESS Sbjct: 280 FGRLGSWNVIMFLTLEQAKKFVRSIESS 307 >XP_012850228.1 PREDICTED: mitochondrial uncoupling protein 1 [Erythranthe guttata] EYU26638.1 hypothetical protein MIMGU_mgv1a0106722mg [Erythranthe guttata] Length = 305 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRS+ESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSVESS 305 >AJC97779.1 mitochondrial uncoupling protein, partial [Actinidia deliciosa] Length = 236 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRSIES+ Sbjct: 209 FGRLGSWNVIMFLTLEQAKKFVRSIESA 236 >AFK41504.1 unknown [Medicago truncatula] Length = 61 Score = 53.9 bits (128), Expect = 2e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKF +S++SS Sbjct: 34 FGRLGSWNVIMFLTLEQAKKFAKSLQSS 61 >OAY43654.1 hypothetical protein MANES_08G086800 [Manihot esculenta] Length = 305 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRS+ESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSLESS 305 >OAY41431.1 hypothetical protein MANES_09G101300 [Manihot esculenta] Length = 305 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVRS+ESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRSLESS 305 >XP_008448974.1 PREDICTED: mitochondrial uncoupling protein 1 [Cucumis melo] Length = 304 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVR+IESS Sbjct: 276 FGRLGSWNVIMFLTLEQAKKFVRNIESS 303 >XP_004147893.1 PREDICTED: mitochondrial uncoupling protein 1 [Cucumis sativus] KGN54348.1 hypothetical protein Csa_4G307900 [Cucumis sativus] Length = 304 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVR+IESS Sbjct: 276 FGRLGSWNVIMFLTLEQAKKFVRNIESS 303 >XP_018838206.1 PREDICTED: mitochondrial uncoupling protein 1-like [Juglans regia] Length = 305 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFV+SIESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVKSIESS 305 >XP_015897075.1 PREDICTED: mitochondrial uncoupling protein 1 [Ziziphus jujuba] Length = 305 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFV+SIESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVKSIESS 305 >XP_008239736.1 PREDICTED: mitochondrial uncoupling protein 1 [Prunus mume] Length = 305 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFV+SIESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVKSIESS 305 >XP_007205615.1 hypothetical protein PRUPE_ppa009102mg [Prunus persica] ONI03617.1 hypothetical protein PRUPE_6G269400 [Prunus persica] Length = 306 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFV+SIESS Sbjct: 279 FGRLGSWNVIMFLTLEQAKKFVKSIESS 306 >XP_007026812.2 PREDICTED: mitochondrial uncoupling protein 1 [Theobroma cacao] Length = 305 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVR++ESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRNLESS 305 >XP_011019168.1 PREDICTED: mitochondrial uncoupling protein 1-like [Populus euphratica] Length = 305 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVR++ESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRNLESS 305 >EOY07314.1 Plant uncoupling mitochondrial protein 1 [Theobroma cacao] Length = 305 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 1 FGRLGSWNVIMFLTLEQAKKFVRSIESS 84 FGRLGSWNVIMFLTLEQAKKFVR++ESS Sbjct: 278 FGRLGSWNVIMFLTLEQAKKFVRNLESS 305