BLASTX nr result
ID: Phellodendron21_contig00002090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00002090 (510 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007418634.1 hypothetical protein MELLADRAFT_118607 [Melampsor... 70 6e-11 >XP_007418634.1 hypothetical protein MELLADRAFT_118607 [Melampsora larici-populina 98AG31] EGF98099.1 hypothetical protein MELLADRAFT_118607 [Melampsora larici-populina 98AG31] Length = 854 Score = 70.1 bits (170), Expect = 6e-11 Identities = 49/145 (33%), Positives = 69/145 (47%), Gaps = 15/145 (10%) Frame = -2 Query: 482 SHHRPAAGLPWGSLLSELRKR----DKPASNLKSRSGLSHSEDDNVRGSSVSEANKACGG 315 S + A+GLPWG LLSELRKR D+ SN K +S ED + S + A Sbjct: 709 SSNNSASGLPWGVLLSELRKRPGWGDRHPSNPKPKSNQESKEDSTTKVKSDDPSKHANDP 768 Query: 314 ADRSADP----------KKVASMRMEPEWSVTGQXXXXXXXXXXXXXXXAKV-GLPQPPA 168 +S+DP K+ A RME +SVT Q + + GLPQPP Sbjct: 769 TKKSSDPKDPDLKKNDEKREAYKRMESSYSVTSQVPPPPAYQSNGSTRKSSLKGLPQPPL 828 Query: 167 LFKVEDFGKTGLSHSEPKRKSITRN 93 L+K ++F ++G S +R T++ Sbjct: 829 LYKAKEFPRSGSSRLVKERPPTTKD 853