BLASTX nr result
ID: Phellodendron21_contig00001597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00001597 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006448093.1 hypothetical protein CICLE_v100161761mg, partial ... 73 1e-14 XP_017184593.1 PREDICTED: anthranilate synthase beta subunit 2, ... 71 1e-13 KDO60850.1 hypothetical protein CISIN_1g027062mg [Citrus sinensis] 73 1e-13 KDO60849.1 hypothetical protein CISIN_1g027062mg [Citrus sinensis] 73 2e-13 KDO60848.1 hypothetical protein CISIN_1g027062mg [Citrus sinensis] 73 3e-13 XP_012072372.1 PREDICTED: anthranilate synthase beta subunit 1, ... 74 5e-13 XP_002314761.1 anthranilate synthase beta subunit 1 family prote... 73 6e-13 EOY01304.1 Anthranilate synthase beta subunit 1 [Theobroma cacao] 73 6e-13 XP_006469298.1 PREDICTED: anthranilate synthase beta subunit 2, ... 73 7e-13 XP_007045472.2 PREDICTED: anthranilate synthase beta subunit 1, ... 73 9e-13 OIW18916.1 hypothetical protein TanjilG_25359 [Lupinus angustifo... 71 1e-12 XP_003547656.1 PREDICTED: anthranilate synthase beta subunit 2, ... 72 2e-12 XP_008220942.1 PREDICTED: anthranilate synthase beta subunit 1, ... 72 2e-12 XP_008220941.1 PREDICTED: anthranilate synthase beta subunit 1, ... 72 2e-12 EEF34857.1 Anthranilate synthase component II, putative [Ricinus... 72 2e-12 XP_002527548.2 PREDICTED: anthranilate synthase beta subunit 1, ... 72 2e-12 KFK44518.1 hypothetical protein AALP_AA1G267100 [Arabis alpina] 71 3e-12 XP_010534169.1 PREDICTED: anthranilate synthase beta subunit 1, ... 71 3e-12 JAU29149.1 Anthranilate synthase beta subunit 1, chloroplastic [... 71 3e-12 XP_009351585.1 PREDICTED: anthranilate synthase beta subunit 1, ... 71 3e-12 >XP_006448093.1 hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] ESR61333.1 hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] Length = 80 Score = 73.2 bits (178), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 KKYKHLQGVQFHPESIIT+EG+TIVRNF+KMI +KEA D Sbjct: 39 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAAD 77 >XP_017184593.1 PREDICTED: anthranilate synthase beta subunit 2, chloroplastic-like [Malus domestica] Length = 94 Score = 71.2 bits (173), Expect = 1e-13 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKY+HLQGVQFHPESIITSEG+TIVRNF+K IEKKE+ Sbjct: 54 KKYRHLQGVQFHPESIITSEGKTIVRNFIKSIEKKES 90 >KDO60850.1 hypothetical protein CISIN_1g027062mg [Citrus sinensis] Length = 174 Score = 73.2 bits (178), Expect = 1e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 KKYKHLQGVQFHPESIIT+EG+TIVRNF+KMI +KEA D Sbjct: 133 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAAD 171 >KDO60849.1 hypothetical protein CISIN_1g027062mg [Citrus sinensis] Length = 192 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 KKYKHLQGVQFHPESIIT+EG+TIVRNF+KMI +KEA D Sbjct: 151 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAAD 189 >KDO60848.1 hypothetical protein CISIN_1g027062mg [Citrus sinensis] Length = 229 Score = 73.2 bits (178), Expect = 3e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 KKYKHLQGVQFHPESIIT+EG+TIVRNF+KMI +KEA D Sbjct: 188 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAAD 226 >XP_012072372.1 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic-like [Jatropha curcas] KDP38169.1 hypothetical protein JCGZ_04812 [Jatropha curcas] Length = 279 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKYKHLQGVQFHPESIITSEG++IVRNFVKMIE+KEA Sbjct: 239 KKYKHLQGVQFHPESIITSEGKSIVRNFVKMIERKEA 275 >XP_002314761.1 anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] EEF00932.1 anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] Length = 276 Score = 73.2 bits (178), Expect = 6e-13 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 +KYKHLQGVQFHPESIITSEG+TIVRNF+KM+E+KEA Sbjct: 236 RKYKHLQGVQFHPESIITSEGKTIVRNFIKMVERKEA 272 >EOY01304.1 Anthranilate synthase beta subunit 1 [Theobroma cacao] Length = 280 Score = 73.2 bits (178), Expect = 6e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 K YKHLQGVQFHPESIITSEG+TIVRNFVK+IEKKEA + Sbjct: 239 KVYKHLQGVQFHPESIITSEGKTIVRNFVKLIEKKEAAE 277 >XP_006469298.1 PREDICTED: anthranilate synthase beta subunit 2, chloroplastic-like [Citrus sinensis] Length = 283 Score = 73.2 bits (178), Expect = 7e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 KKYKHLQGVQFHPESIIT+EG+TIVRNF+KMI +KEA D Sbjct: 242 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAAD 280 >XP_007045472.2 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic [Theobroma cacao] Length = 280 Score = 72.8 bits (177), Expect = 9e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 K YKHLQGVQFHPESIITSEG+TIVRNF+K+IEKKEA + Sbjct: 239 KVYKHLQGVQFHPESIITSEGKTIVRNFIKLIEKKEAAE 277 >OIW18916.1 hypothetical protein TanjilG_25359 [Lupinus angustifolius] Length = 184 Score = 70.9 bits (172), Expect = 1e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEAVD 281 KKYKH+QGVQFHPESII++EG+TIV NFVK+IEKKEA D Sbjct: 145 KKYKHIQGVQFHPESIISTEGKTIVHNFVKLIEKKEADD 183 >XP_003547656.1 PREDICTED: anthranilate synthase beta subunit 2, chloroplastic-like [Glycine max] KHN10817.1 Anthranilate synthase component II [Glycine soja] KRH06976.1 hypothetical protein GLYMA_16G058800 [Glycine max] Length = 278 Score = 72.0 bits (175), Expect = 2e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKYKHLQGVQFHPESIIT EG+TIVRNFVK+IEK+EA Sbjct: 239 KKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKREA 275 >XP_008220942.1 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic-like isoform X2 [Prunus mume] Length = 276 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKY+HLQGVQFHPESIITSEG+TIVRNFVK+IEK+E+ Sbjct: 236 KKYRHLQGVQFHPESIITSEGKTIVRNFVKLIEKRES 272 >XP_008220941.1 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic-like isoform X1 [Prunus mume] Length = 277 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKY+HLQGVQFHPESIITSEG+TIVRNFVK+IEK+E+ Sbjct: 237 KKYRHLQGVQFHPESIITSEGKTIVRNFVKLIEKRES 273 >EEF34857.1 Anthranilate synthase component II, putative [Ricinus communis] Length = 281 Score = 71.6 bits (174), Expect = 2e-12 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKYKHLQGVQFHPESIITSEG+TIV+NF+K++E+KEA Sbjct: 241 KKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEA 277 >XP_002527548.2 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic isoform X1 [Ricinus communis] Length = 284 Score = 71.6 bits (174), Expect = 2e-12 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKYKHLQGVQFHPESIITSEG+TIV+NF+K++E+KEA Sbjct: 244 KKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEA 280 >KFK44518.1 hypothetical protein AALP_AA1G267100 [Arabis alpina] Length = 273 Score = 71.2 bits (173), Expect = 3e-12 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 +KYKH+QGVQFHPESIIT+EG+TIVRNF+K++EKKEA Sbjct: 233 RKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKEA 269 >XP_010534169.1 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic-like [Tarenaya hassleriana] Length = 274 Score = 71.2 bits (173), Expect = 3e-12 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKYKH+QGVQFHPESIIT+EG+TIVRNF+K++E+KEA Sbjct: 234 KKYKHIQGVQFHPESIITTEGKTIVRNFIKLVERKEA 270 >JAU29149.1 Anthranilate synthase beta subunit 1, chloroplastic [Noccaea caerulescens] Length = 275 Score = 71.2 bits (173), Expect = 3e-12 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 +KYKH+QGVQFHPESIIT+EG+TIVRNF+K++EKKEA Sbjct: 235 RKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKEA 271 >XP_009351585.1 PREDICTED: anthranilate synthase beta subunit 1, chloroplastic-like [Pyrus x bretschneideri] Length = 275 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 397 KKYKHLQGVQFHPESIITSEGRTIVRNFVKMIEKKEA 287 KKYKHLQGVQFHPESIITS+G+TIVRNF+K IEKKE+ Sbjct: 235 KKYKHLQGVQFHPESIITSQGKTIVRNFIKSIEKKES 271