BLASTX nr result
ID: Phellodendron21_contig00001490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00001490 (690 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006442383.1 hypothetical protein CICLE_v10023104mg [Citrus cl... 63 1e-09 XP_006442381.1 hypothetical protein CICLE_v10023107mg [Citrus cl... 63 1e-09 XP_006442382.1 hypothetical protein CICLE_v10023104mg [Citrus cl... 59 5e-08 >XP_006442383.1 hypothetical protein CICLE_v10023104mg [Citrus clementina] ESR55623.1 hypothetical protein CICLE_v10023104mg [Citrus clementina] Length = 85 Score = 63.2 bits (152), Expect = 1e-09 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = -3 Query: 499 PKPMFKLPTLKTYPQPRK-AIIVCGNPPRPNXXXXXXXKINSEK-QALNSAQILIKET-E 329 PK KLPT KTY QPRK +IVC NP RP KINSEK ++LN+AQI +KE+ + Sbjct: 10 PKTTLKLPTFKTYQQPRKGVVIVCSNPTRPGGSHGGGGKINSEKPKSLNNAQIEVKESAD 69 Query: 328 KNKPTK 311 KNK K Sbjct: 70 KNKAVK 75 >XP_006442381.1 hypothetical protein CICLE_v10023107mg [Citrus clementina] ESR55621.1 hypothetical protein CICLE_v10023107mg [Citrus clementina] Length = 85 Score = 63.2 bits (152), Expect = 1e-09 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = -3 Query: 499 PKPMFKLPTLKTYPQPRKAI-IVCGNPPRPNXXXXXXXKINSEK-QALNSAQILIKET-E 329 PK KLPTLKTY PRK I IVC NP RP+ +INS+K +LN+AQI +KET + Sbjct: 10 PKTTLKLPTLKTYQLPRKGIVIVCANPERPSGSTRNGGEINSQKPTSLNNAQIAVKETAD 69 Query: 328 KNKPTK 311 KNK K Sbjct: 70 KNKAVK 75 >XP_006442382.1 hypothetical protein CICLE_v10023104mg [Citrus clementina] ESR55622.1 hypothetical protein CICLE_v10023104mg [Citrus clementina] Length = 82 Score = 58.5 bits (140), Expect = 5e-08 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = -3 Query: 499 PKPMFKLPTLKTYPQPRKAIIVCGNPPRPNXXXXXXXKINSEK-QALNSAQILIKET-EK 326 PK KLPT KTY QPRK +++ NP RP KINSEK ++LN+AQI +KE+ +K Sbjct: 10 PKTTLKLPTFKTYQQPRKGVVI--NPTRPGGSHGGGGKINSEKPKSLNNAQIEVKESADK 67 Query: 325 NKPTK 311 NK K Sbjct: 68 NKAVK 72