BLASTX nr result
ID: Phellodendron21_contig00001254
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00001254 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBL51099.1 PG1 protein, homology to Homo sapiens [Lactobacillus ... 104 1e-26 CBL49508.1 PG1 protein, homology to Homo sapiens [Lactobacillus ... 104 1e-26 EEQ24559.1 hypothetical protein LACJE0001_1464 [Lactobacillus je... 103 4e-26 JAN62796.1 hypothetical protein, partial [Daphnia magna] 100 4e-25 JAN90776.1 hypothetical protein, partial [Daphnia magna] 100 4e-25 JAN46010.1 hypothetical protein, partial [Daphnia magna] 100 6e-25 JAN54061.1 hypothetical protein, partial [Daphnia magna] 96 2e-23 JAN54060.1 hypothetical protein, partial [Daphnia magna] 96 2e-23 EPF26580.1 hypothetical protein HMPREF1221_00764, partial [Trepo... 97 7e-23 EFT50296.1 hypothetical protein HMPREF9565_01483 [Propionibacter... 86 2e-19 CDB39267.1 putative uncharacterized protein [Azospirillum sp. CA... 80 5e-17 CDN41090.1 hypothetical protein BN871_AB_00880 [Paenibacillus sp... 81 8e-17 EFH30562.1 hypothetical protein HMPREF0526_10715, partial [Lacto... 76 8e-16 JAN87919.1 hypothetical protein, partial [Daphnia magna] 76 1e-15 JAN29471.1 hypothetical protein, partial [Daphnia magna] 76 1e-15 GAN11782.1 permease, partial [Mucor ambiguus] 76 3e-15 CEH44550.1 conserved hypothetical protein [Xanthomonas citri pv.... 72 2e-14 YP_001312258.1 hypothetical protein CYtaCp093 [Cycas taitungensi... 71 2e-14 JAN94723.1 hypothetical protein, partial [Daphnia magna] 71 2e-14 EYU24190.1 hypothetical protein MIMGU_mgv1a017837mg, partial [Er... 71 3e-14 >CBL51099.1 PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] Length = 144 Score = 104 bits (260), Expect = 1e-26 Identities = 56/94 (59%), Positives = 59/94 (62%) Frame = -1 Query: 283 EFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC 104 EFH PL HS VS A+PRLS GLS QT +AC RFTPN SG RL P YYRGCWH VSR Sbjct: 2 EFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSRD 61 Query: 103 *FFRYRQTAWVLALQISLLIKVLYNPKAFFTHAA 2 YRQ L S LY+PK FFTHAA Sbjct: 62 FLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAA 95 >CBL49508.1 PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] CBL49887.1 PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] CBL49899.1 PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] Length = 144 Score = 104 bits (260), Expect = 1e-26 Identities = 56/94 (59%), Positives = 59/94 (62%) Frame = -1 Query: 283 EFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC 104 EFH PL HS VS A+PRLS GLS QT +AC RFTPN SG RL P YYRGCWH VSR Sbjct: 2 EFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSRD 61 Query: 103 *FFRYRQTAWVLALQISLLIKVLYNPKAFFTHAA 2 YRQ L S LY+PK FFTHAA Sbjct: 62 FLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAA 95 >EEQ24559.1 hypothetical protein LACJE0001_1464 [Lactobacillus jensenii 269-3] Length = 174 Score = 103 bits (258), Expect = 4e-26 Identities = 58/101 (57%), Positives = 61/101 (60%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RI PLH EF PL HS VS A+ RLS LS QT +AC RFTPN SG RL P YYRGC Sbjct: 25 RIPPLHMEFRSPLLHSRLTVSDAVLRLSRRLSHQTYQSACARFTPNKSGQRLPPTYYRGC 84 Query: 124 WHGVSRC*FFRYRQTAWVLALQISLLIKVLYNPKAFFTHAA 2 WH VSR YRQ L S LY+PK FFTHAA Sbjct: 85 WHVVSRDFLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAA 125 >JAN62796.1 hypothetical protein, partial [Daphnia magna] Length = 140 Score = 100 bits (249), Expect = 4e-25 Identities = 50/73 (68%), Positives = 54/73 (73%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RISPLHREFH PL +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGC Sbjct: 30 RISPLHREFHQPLRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGC 89 Query: 124 WHGVSRC*FFRYR 86 WH VSRC RYR Sbjct: 90 WHRVSRCLLRRYR 102 >JAN90776.1 hypothetical protein, partial [Daphnia magna] Length = 141 Score = 100 bits (249), Expect = 4e-25 Identities = 50/73 (68%), Positives = 54/73 (73%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RISPLHREFH PL +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGC Sbjct: 12 RISPLHREFHQPLRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGC 71 Query: 124 WHGVSRC*FFRYR 86 WH VSRC RYR Sbjct: 72 WHRVSRCLLRRYR 84 >JAN46010.1 hypothetical protein, partial [Daphnia magna] Length = 153 Score = 100 bits (249), Expect = 6e-25 Identities = 50/73 (68%), Positives = 54/73 (73%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RISPLHREFH PL +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGC Sbjct: 12 RISPLHREFHQPLRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGC 71 Query: 124 WHGVSRC*FFRYR 86 WH VSRC RYR Sbjct: 72 WHRVSRCLLRRYR 84 >JAN54061.1 hypothetical protein, partial [Daphnia magna] Length = 131 Score = 95.9 bits (237), Expect = 2e-23 Identities = 49/73 (67%), Positives = 53/73 (72%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RISPLHREFH PL +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGC Sbjct: 14 RISPLHREFHQPLRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGC 73 Query: 124 WHGVSRC*FFRYR 86 WH VSR RYR Sbjct: 74 WHRVSRRLLRRYR 86 >JAN54060.1 hypothetical protein, partial [Daphnia magna] Length = 133 Score = 95.9 bits (237), Expect = 2e-23 Identities = 49/73 (67%), Positives = 53/73 (72%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RISPLHREFH PL +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGC Sbjct: 14 RISPLHREFHQPLRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGC 73 Query: 124 WHGVSRC*FFRYR 86 WH VSR RYR Sbjct: 74 WHRVSRRLLRRYR 86 >EPF26580.1 hypothetical protein HMPREF1221_00764, partial [Treponema socranskii subsp. paredis ATCC 35535] Length = 235 Score = 97.4 bits (241), Expect = 7e-23 Identities = 53/101 (52%), Positives = 59/101 (58%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 +ISPLH EF P +SSSPV P LSPG+S Q AC FTPNNS R H YRGC Sbjct: 21 QISPLHTEFRIPFGNSSSPVLNIAPELSPGISYQAWRPACMPFTPNNSEQRSHLTCYRGC 80 Query: 124 WHGVSRC*FFRYRQTAWVLALQISLLIKVLYNPKAFFTHAA 2 WH +SRC F YR + + S K LYN AFF HAA Sbjct: 81 WHVISRCLFLPYRHHVGISSNTYSSDRKELYNLPAFFVHAA 121 >EFT50296.1 hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] Length = 113 Score = 85.5 bits (210), Expect = 2e-19 Identities = 43/78 (55%), Positives = 49/78 (62%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RI PLH+EFH PL SS PVS A LSP ++ T FTPN SG R HP Y+RGC Sbjct: 2 RIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLPTRSTTYEPFTPNKSGQRSHPTYHRGC 61 Query: 124 WHGVSRC*FFRYRQTAWV 71 WH VSRC F YR + +V Sbjct: 62 WHVVSRCFFTHYRHSRFV 79 >CDB39267.1 putative uncharacterized protein [Azospirillum sp. CAG:260] Length = 146 Score = 80.1 bits (196), Expect = 5e-17 Identities = 42/73 (57%), Positives = 50/73 (68%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGC 125 RISPLH FH+PL +SS V +AIP+LS G+S + + A FTP+NS RL P YYRGC Sbjct: 25 RISPLHWVFHYPLCNSSHIVIMAIPKLSSGISPLSYITAYTPFTPSNSEQRLPPSYYRGC 84 Query: 124 WHGVSRC*FFRYR 86 WH VSR F YR Sbjct: 85 WHEVSRGFFRCYR 97 >CDN41090.1 hypothetical protein BN871_AB_00880 [Paenibacillus sp. P22] Length = 217 Score = 81.3 bits (199), Expect = 8e-17 Identities = 42/75 (56%), Positives = 47/75 (62%) Frame = -1 Query: 226 LSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC*FFRYRQTAWVLALQISLL 47 LSP + +T AAC RFTPNNSG RL P YYRGCWH VS+ RYR + S L Sbjct: 94 LSPKIKHRTYKAACARFTPNNSGQRLPPTYYRGCWHVVSQGFLLRYRHGGSSYSSTRSSL 153 Query: 46 IKVLYNPKAFFTHAA 2 LY+PKAF THAA Sbjct: 154 ATELYDPKAFLTHAA 168 >EFH30562.1 hypothetical protein HMPREF0526_10715, partial [Lactobacillus jensenii JV-V16] Length = 120 Score = 76.3 bits (186), Expect = 8e-16 Identities = 41/71 (57%), Positives = 43/71 (60%) Frame = -1 Query: 214 LSQQT*LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC*FFRYRQTAWVLALQISLLIKVL 35 LS QT +AC RFTPN SG RL P YYRGCWH VSR YRQ L S L Sbjct: 1 LSHQTYQSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTEL 60 Query: 34 YNPKAFFTHAA 2 Y+PK FFTHAA Sbjct: 61 YDPKTFFTHAA 71 >JAN87919.1 hypothetical protein, partial [Daphnia magna] Length = 245 Score = 76.3 bits (186), Expect(3) = 1e-15 Identities = 39/61 (63%), Positives = 43/61 (70%) Frame = -1 Query: 268 LTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC*FFRY 89 L +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGCWH VSRC RY Sbjct: 87 LRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGCWHRVSRCLLRRY 146 Query: 88 R 86 R Sbjct: 147 R 147 Score = 33.5 bits (75), Expect(3) = 1e-15 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -2 Query: 78 HGY*PCRFRS**KCFTTRRPSSHTR 4 HGY PC R + FTTRRPSS TR Sbjct: 150 HGYSPCLIRLSPQSFTTRRPSSPTR 174 Score = 20.4 bits (41), Expect(3) = 1e-15 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 300 FHRYTGNSTIL*HTLARQ 247 FH YT NST L T R+ Sbjct: 42 FHLYTENSTNLSDTQPRK 59 >JAN29471.1 hypothetical protein, partial [Daphnia magna] Length = 206 Score = 76.3 bits (186), Expect(3) = 1e-15 Identities = 39/61 (63%), Positives = 43/61 (70%) Frame = -1 Query: 268 LTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC*FFRY 89 L +SS V A+PRLSPGLS T +AA RFTP+NS RLHP YRGCWH VSRC RY Sbjct: 89 LRYSSHAVLNALPRLSPGLSHPTYMAAYTRFTPSNSEQRLHPLSYRGCWHRVSRCLLRRY 148 Query: 88 R 86 R Sbjct: 149 R 149 Score = 33.5 bits (75), Expect(3) = 1e-15 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -2 Query: 78 HGY*PCRFRS**KCFTTRRPSSHTR 4 HGY PC R + FTTRRPSS TR Sbjct: 152 HGYSPCLIRLSPQSFTTRRPSSPTR 176 Score = 20.4 bits (41), Expect(3) = 1e-15 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 300 FHRYTGNSTIL*HTLARQ 247 FH YT NST L T R+ Sbjct: 42 FHLYTENSTNLSDTQPRK 59 >GAN11782.1 permease, partial [Mucor ambiguus] Length = 181 Score = 76.3 bits (186), Expect = 3e-15 Identities = 37/65 (56%), Positives = 42/65 (64%) Frame = -1 Query: 196 LAACGRFTPNNSG*RLHPPYYRGCWHGVSRC*FFRYRQTAWVLALQISLLIKVLYNPKAF 17 + AC RFTPNNSG RL P YYRGCWH VSR RYR + ++ S L LY+PK F Sbjct: 1 MTACARFTPNNSGQRLPPTYYRGCWHVVSRGFLLRYRHSDSSYSIGRSSLATELYDPKTF 60 Query: 16 FTHAA 2 THAA Sbjct: 61 ITHAA 65 >CEH44550.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH53236.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH63573.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI15548.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI35908.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH45445.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH54619.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH43564.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH65853.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH54717.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH78147.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI07031.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI16180.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH94281.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH96259.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH96714.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH78256.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH86587.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ25534.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ20944.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ48971.1 conserved hypothetical protein [Xanthomonas citri pv. bilvae] CEJ48847.1 conserved hypothetical protein [Xanthomonas citri pv. bilvae] CEL46623.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL39946.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL48748.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL34946.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE39505.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF35106.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF34770.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE39473.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE24912.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE74168.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF22932.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF22096.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF21556.1 conserved hypothetical protein [Xanthomonas citri pv. citri] Length = 99 Score = 72.4 bits (176), Expect = 2e-14 Identities = 34/50 (68%), Positives = 35/50 (70%) Frame = -1 Query: 151 LHPPYYRGCWHGVSRC*FFRYRQTAWVLALQISLLIKVLYNPKAFFTHAA 2 +HP YYRGCWH VSRC FF YRQ VL S K LYNPKAFFTHAA Sbjct: 1 MHPSYYRGCWHEVSRCLFFGYRQNNRVLTDCFSFPTKGLYNPKAFFTHAA 50 >YP_001312258.1 hypothetical protein CYtaCp093 [Cycas taitungensis] YP_001312280.1 hypothetical protein CYtaCp115 [Cycas taitungensis] YP_007474603.1 hypothetical_protein (chloroplast) [Cycas revoluta] YP_007474689.1 hypothetical_protein (chloroplast) [Cycas revoluta] YP_009308173.1 hypothetical protein (chloroplast) [Cycas panzhihuaensis] YP_009308259.1 hypothetical protein (chloroplast) [Cycas panzhihuaensis] BAF65000.1 hypothetical protein (chloroplast) [Cycas taitungensis] BAF65022.1 hypothetical protein (chloroplast) [Cycas taitungensis] AEX99153.1 hypothetical_protein (chloroplast) [Cycas revoluta] AEX99238.1 hypothetical_protein (chloroplast) [Cycas revoluta] AOS53122.1 hypothetical protein (chloroplast) [Cycas panzhihuaensis] AOS53208.1 hypothetical protein (chloroplast) [Cycas panzhihuaensis] Length = 75 Score = 71.2 bits (173), Expect = 2e-14 Identities = 40/63 (63%), Positives = 44/63 (69%) Frame = -3 Query: 302 HFTATPGIPPSSDTL*LASIHCHSQVEPGAFTTDLISRLRTLYAQ*FRITLASPVLPRLL 123 HFTA P IP + L L S H S+VEP T DL S L+TLYAQ FRITLAS VLPRLL Sbjct: 13 HFTAPPEIPSAPTVLQLGSFHRLSRVEPWDLTADLKSHLQTLYAQSFRITLASSVLPRLL 72 Query: 122 ARS 114 A+S Sbjct: 73 AQS 75 >JAN94723.1 hypothetical protein, partial [Daphnia magna] Length = 77 Score = 71.2 bits (173), Expect = 2e-14 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 304 RISPLHREFHHPLTHSSSPVSIAIPRLSPGLSQQT*LAACGRFTPNNS 161 RISPLHR+FHHPL +SSS V A+PRLSPG+S+ + AAC RFTP+NS Sbjct: 29 RISPLHRKFHHPLPYSSSAVLKAVPRLSPGISRLSYKAACARFTPSNS 76 >EYU24190.1 hypothetical protein MIMGU_mgv1a017837mg, partial [Erythranthe guttata] Length = 86 Score = 71.2 bits (173), Expect = 3e-14 Identities = 40/63 (63%), Positives = 44/63 (69%) Frame = -3 Query: 302 HFTATPGIPPSSDTL*LASIHCHSQVEPGAFTTDLISRLRTLYAQ*FRITLASPVLPRLL 123 HFTA P IP + L L S H S+VEP T DL S L+TLYAQ FRITLAS VLPRLL Sbjct: 24 HFTALPEIPSAPTVLQLGSFHRLSRVEPWDLTADLKSHLQTLYAQSFRITLASSVLPRLL 83 Query: 122 ARS 114 A+S Sbjct: 84 AQS 86