BLASTX nr result
ID: Phellodendron21_contig00001056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00001056 (808 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417112.1 hypothetical protein MELLADRAFT_118251 [Melampsor... 60 8e-07 >XP_007417112.1 hypothetical protein MELLADRAFT_118251 [Melampsora larici-populina 98AG31] EGF99635.1 hypothetical protein MELLADRAFT_118251 [Melampsora larici-populina 98AG31] Length = 568 Score = 60.5 bits (145), Expect = 8e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = +2 Query: 32 DWSKLPAATEDP--SEWSKPQEMLSTDQAEVVARTIDWAEDV 151 +W+ P+ E P S+WSKP EMLS+DQAEVVARTIDWAEDV Sbjct: 387 NWNANPSKEEAPQSSDWSKPTEMLSSDQAEVVARTIDWAEDV 428