BLASTX nr result
ID: Phellodendron21_contig00001034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00001034 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO55015.1 hypothetical protein CISIN_1g030198mg [Citrus sinensis] 115 2e-30 KDO55014.1 hypothetical protein CISIN_1g030198mg [Citrus sinensis] 115 2e-30 XP_006351360.1 PREDICTED: eukaryotic translation initiation fact... 116 3e-30 XP_004249299.1 PREDICTED: eukaryotic translation initiation fact... 116 3e-30 XP_016548322.1 PREDICTED: eukaryotic translation initiation fact... 116 3e-30 XP_004288413.1 PREDICTED: eukaryotic translation initiation fact... 115 3e-30 XP_015386166.1 PREDICTED: eukaryotic translation initiation fact... 115 6e-30 XP_006443436.1 hypothetical protein CICLE_v10022151mg [Citrus cl... 115 7e-30 KYP62102.1 Eukaryotic translation initiation factor 4E type 3 [C... 115 7e-30 XP_009599484.1 PREDICTED: eukaryotic translation initiation fact... 114 1e-29 NP_001312745.1 eukaryotic translation initiation factor NCBP-lik... 114 1e-29 XP_011075053.1 PREDICTED: eukaryotic translation initiation fact... 114 2e-29 XP_015088851.1 PREDICTED: eukaryotic translation initiation fact... 114 2e-29 XP_012070439.1 PREDICTED: eukaryotic translation initiation fact... 114 2e-29 XP_002281697.1 PREDICTED: eukaryotic translation initiation fact... 114 2e-29 XP_018820086.1 PREDICTED: eukaryotic translation initiation fact... 114 2e-29 OAY44381.1 hypothetical protein MANES_08G145200 [Manihot esculenta] 114 2e-29 XP_016180557.1 PREDICTED: eukaryotic translation initiation fact... 113 3e-29 XP_015946885.1 PREDICTED: eukaryotic translation initiation fact... 113 3e-29 CDP14308.1 unnamed protein product [Coffea canephora] 113 3e-29 >KDO55015.1 hypothetical protein CISIN_1g030198mg [Citrus sinensis] Length = 164 Score = 115 bits (287), Expect = 2e-30 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS LPSP Sbjct: 42 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSP 96 >KDO55014.1 hypothetical protein CISIN_1g030198mg [Citrus sinensis] Length = 181 Score = 115 bits (287), Expect = 2e-30 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS LPSP Sbjct: 42 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSP 96 >XP_006351360.1 PREDICTED: eukaryotic translation initiation factor NCBP [Solanum tuberosum] Length = 223 Score = 116 bits (290), Expect = 3e-30 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS+LPSP Sbjct: 45 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSALPSP 99 >XP_004249299.1 PREDICTED: eukaryotic translation initiation factor NCBP [Solanum lycopersicum] Length = 223 Score = 116 bits (290), Expect = 3e-30 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS+LPSP Sbjct: 45 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSALPSP 99 >XP_016548322.1 PREDICTED: eukaryotic translation initiation factor NCBP [Capsicum annuum] Length = 224 Score = 116 bits (290), Expect = 3e-30 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS+LPSP Sbjct: 46 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSTLPSP 100 >XP_004288413.1 PREDICTED: eukaryotic translation initiation factor NCBP [Fragaria vesca subsp. vesca] Length = 219 Score = 115 bits (289), Expect = 3e-30 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVR+QTSYEDNIKKIVDF TVEGFWVCYCHLARPSSLPSP Sbjct: 41 PLKNKFVFWYTRRTPGVRSQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSSLPSP 95 >XP_015386166.1 PREDICTED: eukaryotic translation initiation factor NCBP [Citrus sinensis] Length = 218 Score = 115 bits (287), Expect = 6e-30 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS LPSP Sbjct: 42 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSP 96 >XP_006443436.1 hypothetical protein CICLE_v10022151mg [Citrus clementina] ESR56676.1 hypothetical protein CICLE_v10022151mg [Citrus clementina] Length = 220 Score = 115 bits (287), Expect = 7e-30 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS LPSP Sbjct: 42 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSP 96 >KYP62102.1 Eukaryotic translation initiation factor 4E type 3 [Cajanus cajan] Length = 235 Score = 115 bits (288), Expect = 7e-30 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVR QTSYEDNIKKIVDF TVEGFWVCYCHLARPSSLPSP Sbjct: 57 PLKNKFVFWYTRRTPGVRNQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSSLPSP 111 >XP_009599484.1 PREDICTED: eukaryotic translation initiation factor NCBP-like [Nicotiana tomentosiformis] Length = 212 Score = 114 bits (285), Expect = 1e-29 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS+LPSP Sbjct: 34 PLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSTLPSP 88 >NP_001312745.1 eukaryotic translation initiation factor NCBP-like [Nicotiana tabacum] XP_009763629.1 PREDICTED: eukaryotic translation initiation factor NCBP-like [Nicotiana sylvestris] AIG20714.1 eukaryotic translation initiation factor NCBP-like protein [Nicotiana tabacum] Length = 212 Score = 114 bits (285), Expect = 1e-29 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPS+LPSP Sbjct: 34 PLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSTLPSP 88 >XP_011075053.1 PREDICTED: eukaryotic translation initiation factor NCBP [Sesamum indicum] Length = 216 Score = 114 bits (284), Expect = 2e-29 Identities = 50/55 (90%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVE FWVCYCHLARPS+LPSP Sbjct: 38 PLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEAFWVCYCHLARPSTLPSP 92 >XP_015088851.1 PREDICTED: eukaryotic translation initiation factor NCBP [Solanum pennellii] Length = 223 Score = 114 bits (284), Expect = 2e-29 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P NKFVFW+TRRTPGVRTQTSYEDNIKKI+DF TVEGFWVCYCHLARPS+LPSP Sbjct: 45 PLKNKFVFWHTRRTPGVRTQTSYEDNIKKIIDFSTVEGFWVCYCHLARPSALPSP 99 >XP_012070439.1 PREDICTED: eukaryotic translation initiation factor NCBP [Jatropha curcas] KDP39693.1 hypothetical protein JCGZ_02713 [Jatropha curcas] Length = 224 Score = 114 bits (284), Expect = 2e-29 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVRTQTSYEDNIKKIV+F TVEGFWVCYCHLARPSSLPSP Sbjct: 46 PLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVEFSTVEGFWVCYCHLARPSSLPSP 100 >XP_002281697.1 PREDICTED: eukaryotic translation initiation factor NCBP [Vitis vinifera] CBI29949.3 unnamed protein product, partial [Vitis vinifera] Length = 225 Score = 114 bits (284), Expect = 2e-29 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFW+CYCHLARPS+LPSP Sbjct: 47 PLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWICYCHLARPSALPSP 101 >XP_018820086.1 PREDICTED: eukaryotic translation initiation factor NCBP [Juglans regia] Length = 241 Score = 114 bits (285), Expect = 2e-29 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P KFVFWYTRRTPGVRTQTSYEDNIKKIVDF TVEGFWVCYCHLARPSSLPSP Sbjct: 63 PLKYKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSSLPSP 117 >OAY44381.1 hypothetical protein MANES_08G145200 [Manihot esculenta] Length = 228 Score = 114 bits (284), Expect = 2e-29 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVRTQTSYEDNIKKIV+F TVEGFWVCYCHLARPSSLPSP Sbjct: 50 PLKHKFVFWYTRRTPGVRTQTSYEDNIKKIVEFSTVEGFWVCYCHLARPSSLPSP 104 >XP_016180557.1 PREDICTED: eukaryotic translation initiation factor NCBP [Arachis ipaensis] Length = 224 Score = 113 bits (283), Expect = 3e-29 Identities = 50/55 (90%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVR QTSYEDNIKKIVDF TVEGFWVCYCHLARPSSLPSP Sbjct: 46 PLKHKFVFWYTRRTPGVRNQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSSLPSP 100 >XP_015946885.1 PREDICTED: eukaryotic translation initiation factor NCBP [Arachis duranensis] Length = 224 Score = 113 bits (283), Expect = 3e-29 Identities = 50/55 (90%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVR QTSYEDNIKKIVDF TVEGFWVCYCHLARPSSLPSP Sbjct: 46 PLKHKFVFWYTRRTPGVRNQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSSLPSP 100 >CDP14308.1 unnamed protein product [Coffea canephora] Length = 231 Score = 113 bits (283), Expect = 3e-29 Identities = 50/55 (90%), Positives = 51/55 (92%) Frame = +2 Query: 146 PFTNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFCTVEGFWVCYCHLARPSSLPSP 310 P +KFVFWYTRRTPGVRTQ SYEDNIKKIVDF TVEGFWVCYCHLARPSSLPSP Sbjct: 53 PLKHKFVFWYTRRTPGVRTQASYEDNIKKIVDFSTVEGFWVCYCHLARPSSLPSP 107