BLASTX nr result
ID: Phellodendron21_contig00001011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00001011 (592 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO51183.1 hypothetical protein CISIN_1g044965mg, partial [Citru... 81 2e-17 OAY52929.1 hypothetical protein MANES_04G123000 [Manihot esculenta] 82 2e-16 XP_015867710.1 PREDICTED: protein SYS1 homolog [Ziziphus jujuba] 82 2e-16 KJB70514.1 hypothetical protein B456_011G077000 [Gossypium raimo... 81 3e-16 XP_017648120.1 PREDICTED: protein SYS1 homolog [Gossypium arboreum] 81 4e-16 XP_016698104.1 PREDICTED: protein SYS1 homolog [Gossypium hirsutum] 81 4e-16 XP_015938373.1 PREDICTED: protein SYS1 homolog [Arachis duranens... 81 4e-16 XP_012453757.1 PREDICTED: protein SYS1 homolog [Gossypium raimon... 81 4e-16 XP_006465557.1 PREDICTED: protein SYS1 homolog [Citrus sinensis]... 81 4e-16 XP_006427044.1 hypothetical protein CICLE_v10026697mg [Citrus cl... 81 4e-16 XP_006494126.1 PREDICTED: protein SYS1 homolog [Citrus sinensis]... 81 6e-16 XP_010254166.1 PREDICTED: protein SYS1 homolog [Nelumbo nucifera] 80 8e-16 GAV72678.1 SYS1 domain-containing protein [Cephalotus follicularis] 80 1e-15 XP_019443409.1 PREDICTED: protein SYS1 homolog [Lupinus angustif... 80 1e-15 XP_017218209.1 PREDICTED: protein SYS1 homolog [Daucus carota su... 80 2e-15 XP_015580271.1 PREDICTED: protein SYS1 homolog [Ricinus communis] 79 3e-15 CDO98068.1 unnamed protein product [Coffea canephora] 79 3e-15 XP_008353650.1 PREDICTED: protein SYS1 homolog isoform X2 [Malus... 79 3e-15 XP_007215109.1 hypothetical protein PRUPE_ppa012830mg [Prunus pe... 79 3e-15 XP_007024091.2 PREDICTED: protein SYS1 homolog [Theobroma cacao] 79 4e-15 >KDO51183.1 hypothetical protein CISIN_1g044965mg, partial [Citrus sinensis] Length = 43 Score = 81.3 bits (199), Expect = 2e-17 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTGLALMALLGEYLCIRRELREIPI RYRS+V Sbjct: 4 SITWWVVNGTGLALMALLGEYLCIRRELREIPIPRYRSNV 43 >OAY52929.1 hypothetical protein MANES_04G123000 [Manihot esculenta] Length = 152 Score = 82.0 bits (201), Expect = 2e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWW+VNGTGLA+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWIVNGTGLAVMALLGEYLCIRRELREIPITRYRSNV 152 >XP_015867710.1 PREDICTED: protein SYS1 homolog [Ziziphus jujuba] Length = 152 Score = 82.0 bits (201), Expect = 2e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTG+A+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWVVNGTGIAIMALLGEYLCIRRELREIPITRYRSNV 152 >KJB70514.1 hypothetical protein B456_011G077000 [Gossypium raimondii] Length = 139 Score = 81.3 bits (199), Expect = 3e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTG+A+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 100 SITWWVVNGTGVAVMALLGEYLCIRRELREIPITRYRSNV 139 >XP_017648120.1 PREDICTED: protein SYS1 homolog [Gossypium arboreum] Length = 152 Score = 81.3 bits (199), Expect = 4e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTG+A+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWVVNGTGVAVMALLGEYLCIRRELREIPITRYRSNV 152 >XP_016698104.1 PREDICTED: protein SYS1 homolog [Gossypium hirsutum] Length = 152 Score = 81.3 bits (199), Expect = 4e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTG+A+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWVVNGTGVAVMALLGEYLCIRRELREIPITRYRSNV 152 >XP_015938373.1 PREDICTED: protein SYS1 homolog [Arachis duranensis] XP_016174470.1 PREDICTED: protein SYS1 homolog [Arachis ipaensis] Length = 152 Score = 81.3 bits (199), Expect = 4e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWW+VNGTGLA MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWIVNGTGLAAMALLGEYLCIRRELREIPITRYRSNV 152 >XP_012453757.1 PREDICTED: protein SYS1 homolog [Gossypium raimondii] KJB70513.1 hypothetical protein B456_011G077000 [Gossypium raimondii] Length = 152 Score = 81.3 bits (199), Expect = 4e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTG+A+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWVVNGTGVAVMALLGEYLCIRRELREIPITRYRSNV 152 >XP_006465557.1 PREDICTED: protein SYS1 homolog [Citrus sinensis] XP_006465558.1 PREDICTED: protein SYS1 homolog [Citrus sinensis] Length = 152 Score = 81.3 bits (199), Expect = 4e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTGLALMALLGEYLCIRRELREIPI RYRS+V Sbjct: 113 SITWWVVNGTGLALMALLGEYLCIRRELREIPIPRYRSNV 152 >XP_006427044.1 hypothetical protein CICLE_v10026697mg [Citrus clementina] ESR40284.1 hypothetical protein CICLE_v10026697mg [Citrus clementina] Length = 152 Score = 81.3 bits (199), Expect = 4e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTGLALMALLGEYLCIRRELREIPI RYRS+V Sbjct: 113 SITWWVVNGTGLALMALLGEYLCIRRELREIPIPRYRSNV 152 >XP_006494126.1 PREDICTED: protein SYS1 homolog [Citrus sinensis] XP_015381410.1 PREDICTED: protein SYS1 homolog [Citrus sinensis] Length = 159 Score = 80.9 bits (198), Expect = 6e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSS 117 SITWWVVNGTGLALMALLGEYLCIRRELREIPI RYRSS Sbjct: 113 SITWWVVNGTGLALMALLGEYLCIRRELREIPIPRYRSS 151 >XP_010254166.1 PREDICTED: protein SYS1 homolog [Nelumbo nucifera] Length = 152 Score = 80.5 bits (197), Expect = 8e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTGLA+MALLGE+LCIRRELREIPITRYRS+V Sbjct: 113 SITWWVVNGTGLAVMALLGEWLCIRRELREIPITRYRSNV 152 >GAV72678.1 SYS1 domain-containing protein [Cephalotus follicularis] Length = 152 Score = 80.1 bits (196), Expect = 1e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWV+NGTG+ALMALLGEYLCIRRELREIPITRYRS V Sbjct: 113 SITWWVLNGTGVALMALLGEYLCIRRELREIPITRYRSVV 152 >XP_019443409.1 PREDICTED: protein SYS1 homolog [Lupinus angustifolius] XP_019443410.1 PREDICTED: protein SYS1 homolog [Lupinus angustifolius] OIW11904.1 hypothetical protein TanjilG_18177 [Lupinus angustifolius] Length = 152 Score = 80.1 bits (196), Expect = 1e-15 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWW+VNGTG+A+MALLGEYLCI+RELREIPITRYRS+V Sbjct: 113 SITWWIVNGTGIAVMALLGEYLCIKRELREIPITRYRSNV 152 >XP_017218209.1 PREDICTED: protein SYS1 homolog [Daucus carota subsp. sativus] Length = 152 Score = 79.7 bits (195), Expect = 2e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTGLA+MALLGEYLCI+RELREIPITR+RS+V Sbjct: 113 SITWWVVNGTGLAVMALLGEYLCIKRELREIPITRFRSNV 152 >XP_015580271.1 PREDICTED: protein SYS1 homolog [Ricinus communis] Length = 152 Score = 79.0 bits (193), Expect = 3e-15 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 S+TWWVV+GTGLA+MALLGEYLCIRREL+EIPITRYRS+V Sbjct: 113 SVTWWVVSGTGLAVMALLGEYLCIRRELKEIPITRYRSNV 152 >CDO98068.1 unnamed protein product [Coffea canephora] Length = 152 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVN TGLA+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SITWWVVNVTGLAVMALLGEYLCIRRELREIPITRYRSNV 152 >XP_008353650.1 PREDICTED: protein SYS1 homolog isoform X2 [Malus domestica] Length = 152 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVN TGLALMALLGEYLCIRRELREIPITRYR++V Sbjct: 113 SITWWVVNVTGLALMALLGEYLCIRRELREIPITRYRANV 152 >XP_007215109.1 hypothetical protein PRUPE_ppa012830mg [Prunus persica] XP_016649235.1 PREDICTED: protein SYS1 homolog [Prunus mume] ONI15977.1 hypothetical protein PRUPE_3G071900 [Prunus persica] ONI15978.1 hypothetical protein PRUPE_3G071900 [Prunus persica] Length = 152 Score = 79.0 bits (193), Expect = 3e-15 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 SITWWVVNGTG+A+MALLGEYLCIRREL+EIPITR+RS+V Sbjct: 113 SITWWVVNGTGIAVMALLGEYLCIRRELKEIPITRFRSNV 152 >XP_007024091.2 PREDICTED: protein SYS1 homolog [Theobroma cacao] Length = 152 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 1 SITWWVVNGTGLALMALLGEYLCIRRELREIPITRYRSSV 120 S+TWWVVNG G+A+MALLGEYLCIRRELREIPITRYRS+V Sbjct: 113 SVTWWVVNGIGVAVMALLGEYLCIRRELREIPITRYRSNV 152