BLASTX nr result
ID: Phellodendron21_contig00000733
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00000733 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONL98751.1 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B [Ze... 53 8e-06 ONL98765.1 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B [Ze... 53 8e-06 >ONL98751.1 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B [Zea mays] Length = 1368 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 324 PIFVGSRAKRLLERAVWNDTAFLAVSRN*LL 232 PIFVG++AKRLLERAVWNDT+FLAVS N +L Sbjct: 1316 PIFVGNKAKRLLERAVWNDTSFLAVSINHML 1346 >ONL98765.1 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B [Zea mays] ONL98767.1 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B [Zea mays] Length = 1741 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 324 PIFVGSRAKRLLERAVWNDTAFLAVSRN*LL 232 PIFVG++AKRLLERAVWNDT+FLAVS N +L Sbjct: 1689 PIFVGNKAKRLLERAVWNDTSFLAVSINHML 1719